SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284039948|ref|YP_003389878.1| from Spirosoma linguale DSM 74

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284039948|ref|YP_003389878.1|
Domain Number 1 Region: 95-228
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 6.28e-34
Family Ferredoxin domains from multidomain proteins 0.00024
Further Details:      
 
Domain Number 2 Region: 10-91
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 0.00000000000000374
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284039948|ref|YP_003389878.1|
Sequence length 361
Comment NADH:ubiquinone oxidoreductase subunit G iron- sulfur binding protein [Spirosoma linguale DSM 74]
Sequence
MEDVKPQLLKVTIDGIEVEVEPGTTILQAARKIGPAVAPPAMCYYQPLKGSGGKCRACLV
RVAAGSAKDPRPMPKLVASCLTAVQDGMIVENETSPQVIDARNGIVEFLLLNHPLDCPVC
DQAGECDLQNFAFDHGKATTRYEEDRRTFEKRDIGPNIQLHMTRCILCYRCVYTADQITN
KRVHGVMNRGDASEISTYIEKAIDNDFSGNVIDVCPVGALTDKTYRFKNRVWFTKPVDAH
RNCPTCSGKVTLWYRGDEVIRVTARKNEWNEVTEFICNTCRFETKKTSDWTIEGPTKISR
SSVISANKYRADTVKPSFGERLAAADYKPIDDKRDTSQLAIQQLPAERFAHVLPAALDPE
P
Download sequence
Identical sequences D2QGQ7
gi|284039948|ref|YP_003389878.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]