SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283456173|ref|YP_003360737.1| from Bifidobacterium dentium Bd1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283456173|ref|YP_003360737.1|
Domain Number 1 Region: 6-387
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 2.62e-122
Family ArgJ-like 0.00000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|283456173|ref|YP_003360737.1|
Sequence length 390
Comment glutamate N-acetyltransferase/amino-acid acetyltransferase [Bifidobacterium dentium Bd1]
Sequence
MSVTFAQGFSAAGVAAGISAVEGKKDMALVVNNGPLDAAAAVFTTNRFCAAPVQWSRKVV
ADGHVKAVILNSGGANACTGKPGYEQSQATAEKVAELLGASANDVAVCSTGLIGELLPLD
HVLSGTEAAFAALSDSVEAGENASYAIMTTDTKPKTVELEGSTGFRVGGMVKGSGMIAPQ
LATMLCVITTDAVVNAGQLQAALNAGVEMSFNRIDVDGCMSTNDTVLLLASGASGVEPDP
DEFNDLVAKATASLARQIVGDGEGASHDIRVKVTGATTEDAALACGRAVAASNLLKCAIA
GNDPNWGRILSSLGTVSPEDAPFDAEKVTVDVNGVRICENGGAGRDRSEVDMTPREVHID
IDLNEGDAEASVWTDDLTHEYVHINADYES
Download sequence
Identical sequences D2QAS7 W2VDK9
WP_003839881.1.11892 WP_003839881.1.14814 WP_003839881.1.2424 WP_003839881.1.39260 WP_003839881.1.42327 WP_003839881.1.53636 WP_003839881.1.91619 gi|283456173|ref|YP_003360737.1| 401473.BDP_1295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]