SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|259906907|ref|YP_002647263.1| from Erwinia pyrifoliae Ep1/96

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|259906907|ref|YP_002647263.1|
Domain Number - Region: 32-135
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0575
Family Apolipoprotein 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|259906907|ref|YP_002647263.1|
Sequence length 179
Comment sec-independent protein translocase protein TatB [Erwinia pyrifoliae Ep1/96]
Sequence
MFDIGFSELVLVFIIGLVVLGPQRLPVAVRTVMGWIRALRSLATSVQNELAQELKFQELQ
DGLKKIEQVSKDNLSPELKASVEELKQTANSMKRSYLSENEKADDEAHTIRNPLQKDAQE
AHDGVTPAQADLQADAPAQAPVTVTQKASSEPQPDIKQEPPAPVAPRASVTSTPPSDER
Download sequence
Identical sequences D2TCU0
WP_012666607.1.53124 WP_012666607.1.74942 gi|259906907|ref|YP_002647263.1| 634499.EpC_02260 gi|387869617|ref|YP_005800987.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]