SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|259907790|ref|YP_002648146.1| from Erwinia pyrifoliae Ep1/96

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|259907790|ref|YP_002648146.1|
Domain Number 1 Region: 347-533
Classification Level Classification E-value
Superfamily Colicin 2.22e-62
Family Colicin 0.00000662
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|259907790|ref|YP_002648146.1|
Sequence length 533
Comment hypothetical protein EpC_11210 [Erwinia pyrifoliae Ep1/96]
Sequence
MATLAYYRDGIPYGTDGHVIITITGDPVGAGSLIGSNTARPVYVGWPGMGSQMSHGTGPV
AHYDSNKLGHHSLTSIREGQAQINQLMTKARSAYHQNGEQIVRESTDLLDSLRKSGLIHH
AELNTAVAALEEALKALQANMALKNNAEQDVSAKTQATTTAFEQFIARDDVKMHNFKDAR
PFVFDFVLSISPIYHHIIELWNRFYLPKLQQEMEEKNNLVTYLDRVKIICDDVINKTKHL
NNEKIRIEKKEQVIKELEEHKNRPTPIADAKNPLTDVAIKPLMPEPVVIKPVIVEPVVIE
PPLTPFITIIPDLALQKPAALIPFVPIKTTPLRPPPVHPLIPFKPLAEEDKDNDETISAV
KFTADFYKELTEKWGGKSAEIAQELAWDVKGKQIRNADEALDSFEKYKDVLSKKFSLKDR
EAISKALESLTQAEIAKNFVRFSKGLGLVSSGIDVYETAMEFKKAIDSHNWRPFYVKLET
LLAGKGASALTAFAYSLILATPIGILGFAFIMTLVGVFVDEKFVEKINRALGI
Download sequence
Identical sequences D2T791
gi|387870571|ref|YP_005801942.1| WP_012667462.1.53124 WP_012667462.1.74942 gi|259907790|ref|YP_002648146.1| 634499.EpC_11210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]