SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|259908534|ref|YP_002648890.1| from Erwinia pyrifoliae Ep1/96

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|259908534|ref|YP_002648890.1|
Domain Number 1 Region: 20-100
Classification Level Classification E-value
Superfamily Apolipoprotein 0.000000000589
Family Apolipoprotein 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|259908534|ref|YP_002648890.1|
Sequence length 126
Comment hypothetical protein EpC_18840 [Erwinia pyrifoliae Ep1/96]
Sequence
MQQEIRLTPSCDDMTAIKLSQQEIKRDIHELRKEVKEDTGALRQEVKQDISALRQEVKQD
FEALRTEVKQDIGALHQGMNNDMSHLRQDMYRLQQHARTDFRLLFGALISLAIGMSGLVA
KAFNWI
Download sequence
Identical sequences D2TBI1
WP_012668188.1.53124 WP_012668188.1.74942 gi|259908534|ref|YP_002648890.1| gi|387871408|ref|YP_005802782.1| 634499.EpC_18840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]