SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289208074|ref|YP_003460140.1| from Thioalkalivibrio sp. K90mix

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289208074|ref|YP_003460140.1|
Domain Number 1 Region: 1-104
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 7.67e-27
Family Frataxin-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|289208074|ref|YP_003460140.1|
Sequence length 107
Comment iron donor protein CyaY [Thioalkalivibrio sp. K90mix]
Sequence
MSQPSFAVFAEQTLDEIYNRLSDQDGLDDLDIDLIDGVLTLEFEDGAQMILNRQEAAQQI
WLSSPEGPAHFGYNEDEDAWLDDRNGDDLHETVARVIGQKLGVRVEL
Download sequence
Identical sequences D3SG24
WP_012982299.1.11302 WP_012982299.1.11667 WP_012982299.1.19726 WP_012982299.1.27442 WP_012982299.1.3109 WP_012982299.1.43969 WP_012982299.1.59983 WP_012982299.1.65252 WP_012982299.1.68207 WP_012982299.1.69173 WP_012982299.1.70936 WP_012982299.1.71584 WP_012982299.1.79 WP_012982299.1.80445 WP_012982299.1.95464 WP_012982299.1.95809 WP_012982299.1.98332 gi|289208074|ref|YP_003460140.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]