SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284997513|ref|YP_003419280.1| from Sulfolobus islandicus L.D.8.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284997513|ref|YP_003419280.1|
Domain Number 1 Region: 7-135
Classification Level Classification E-value
Superfamily Single hybrid motif 1.83e-25
Family Biotinyl/lipoyl-carrier proteins and domains 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284997513|ref|YP_003419280.1|
Sequence length 140
Comment glycine cleavage H-protein [Sulfolobus islandicus L.D.8.5]
Sequence
MKILGFTFPDDLLYEPEKHVWVRIEDNNVISIGVTDLGQYMAGKIFQVTAKQKGEKVNGR
SVLFSIESAKWIGKFRLPIEGEVFDVNEEVVKNPSLINERPYDSWIIKIRIEDVDIIKRT
FKPIQEAYKQFEEEAKRVVR
Download sequence
Identical sequences C3MPB7 C3N4Z9 C3NDJ6 C3NI55 D2PJF7 F0NGP7 F0NK40 M9U8P4
gi|284997513|ref|YP_003419280.1| gi|229584618|ref|YP_002843119.1| gi|229578909|ref|YP_002837307.1| gi|479325403|ref|YP_007865458.1| 419942.YN1551_1740 427318.M1627_1186 429572.LS215_1219 439386.YG5714_1118 gi|229582338|ref|YP_002840737.1| gi|227830096|ref|YP_002831875.1| gi|385775709|ref|YP_005648277.1| WP_012713567.1.13477 WP_012713567.1.27011 WP_012713567.1.27461 WP_012713567.1.34992 WP_012713567.1.44962 WP_012713567.1.47130 WP_012713567.1.48461 WP_012713567.1.52267 WP_012713567.1.60638 WP_012713567.1.66823 WP_012713567.1.67233 WP_012713567.1.74483 WP_012713567.1.83431 WP_012713567.1.84481 WP_012713567.1.90709 WP_012713567.1.91160 gi|385773080|ref|YP_005645646.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]