SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260682094|ref|YP_003213379.1| from Clostridium difficile CD196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260682094|ref|YP_003213379.1|
Domain Number 1 Region: 23-116
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.49e-29
Family ArsR-like transcriptional regulators 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|260682094|ref|YP_003213379.1|
Sequence length 121
Comment ArsR family transcriptional regulator [Clostridium difficile CD196]
Sequence
MREEINDCNCNIVHEEIVTEAKSTMPDEEMLYDLAELFKVFGDTTRVKILYALFANEMCV
CDIASLLNMTHSAISHQLRVLKQARLVKFRREGKTVYYSLDDSHISQIFDCGLNHIRETY
K
Download sequence
Identical sequences A0A031WBT5 A0A0H3MYX5 A0A1F2DE14 C9YIC4 Q18D53 T4ICI5
gi|384359652|ref|YP_006197504.1| gi|260685692|ref|YP_003216825.1| gi|260682094|ref|YP_003213379.1| WP_003437587.1.100055 WP_003437587.1.100097 WP_003437587.1.100099 WP_003437587.1.100107 WP_003437587.1.100118 WP_003437587.1.100139 WP_003437587.1.100513 WP_003437587.1.100570 WP_003437587.1.100660 WP_003437587.1.100831 WP_003437587.1.100923 WP_003437587.1.100977 WP_003437587.1.101035 WP_003437587.1.101125 WP_003437587.1.101279 WP_003437587.1.10130 WP_003437587.1.101316 WP_003437587.1.101532 WP_003437587.1.101861 WP_003437587.1.101929 WP_003437587.1.102031 WP_003437587.1.102074 WP_003437587.1.102095 WP_003437587.1.10483 WP_003437587.1.10488 WP_003437587.1.10582 WP_003437587.1.10691 WP_003437587.1.10793 WP_003437587.1.10795 WP_003437587.1.11025 WP_003437587.1.11224 WP_003437587.1.11278 WP_003437587.1.11320 WP_003437587.1.11398 WP_003437587.1.1167 WP_003437587.1.1179 WP_003437587.1.11937 WP_003437587.1.11954 WP_003437587.1.12066 WP_003437587.1.12169 WP_003437587.1.12385 WP_003437587.1.1254 WP_003437587.1.12629 WP_003437587.1.12632 WP_003437587.1.12659 WP_003437587.1.1273 WP_003437587.1.12734 WP_003437587.1.12807 WP_003437587.1.12809 WP_003437587.1.12953 WP_003437587.1.13040 WP_003437587.1.13251 WP_003437587.1.13273 WP_003437587.1.13398 WP_003437587.1.13418 WP_003437587.1.13730 WP_003437587.1.13841 WP_003437587.1.13859 WP_003437587.1.141 WP_003437587.1.14170 WP_003437587.1.14177 WP_003437587.1.14205 WP_003437587.1.1422 WP_003437587.1.14259 WP_003437587.1.14330 WP_003437587.1.14352 WP_003437587.1.1445 WP_003437587.1.14457 WP_003437587.1.14483 WP_003437587.1.14579 WP_003437587.1.14674 WP_003437587.1.14686 WP_003437587.1.14698 WP_003437587.1.14848 WP_003437587.1.1494 WP_003437587.1.15083 WP_003437587.1.15097 WP_003437587.1.15192 WP_003437587.1.15205 WP_003437587.1.15310 WP_003437587.1.15435 WP_003437587.1.15908 WP_003437587.1.16012 WP_003437587.1.16135 WP_003437587.1.16185 WP_003437587.1.16190 WP_003437587.1.16376 WP_003437587.1.16520 WP_003437587.1.16728 WP_003437587.1.16897 WP_003437587.1.169 WP_003437587.1.16931 WP_003437587.1.16966 WP_003437587.1.1705 WP_003437587.1.17371 WP_003437587.1.17413 WP_003437587.1.17463 WP_003437587.1.17512 WP_003437587.1.17611 WP_003437587.1.17638 WP_003437587.1.17808 WP_003437587.1.17851 WP_003437587.1.17879 WP_003437587.1.17908 WP_003437587.1.17960 WP_003437587.1.18060 WP_003437587.1.18207 WP_003437587.1.18298 WP_003437587.1.1838 WP_003437587.1.18407 WP_003437587.1.18455 WP_003437587.1.18462 WP_003437587.1.18551 WP_003437587.1.18680 WP_003437587.1.18805 WP_003437587.1.18970 WP_003437587.1.19088 WP_003437587.1.19152 WP_003437587.1.1926 WP_003437587.1.19290 WP_003437587.1.1934 WP_003437587.1.19627 WP_003437587.1.19648 WP_003437587.1.19704 WP_003437587.1.19899 WP_003437587.1.19956 WP_003437587.1.1999 WP_003437587.1.2002 WP_003437587.1.20132 WP_003437587.1.20184 WP_003437587.1.20302 WP_003437587.1.20313 WP_003437587.1.20481 WP_003437587.1.20650 WP_003437587.1.20728 WP_003437587.1.20872 WP_003437587.1.20875 WP_003437587.1.20960 WP_003437587.1.21000 WP_003437587.1.21048 WP_003437587.1.21201 WP_003437587.1.21220 WP_003437587.1.21417 WP_003437587.1.21502 WP_003437587.1.21520 WP_003437587.1.21547 WP_003437587.1.21618 WP_003437587.1.21704 WP_003437587.1.21893 WP_003437587.1.22020 WP_003437587.1.22079 WP_003437587.1.22128 WP_003437587.1.22222 WP_003437587.1.22228 WP_003437587.1.22313 WP_003437587.1.22357 WP_003437587.1.22411 WP_003437587.1.22417 WP_003437587.1.22568 WP_003437587.1.22569 WP_003437587.1.22615 WP_003437587.1.22768 WP_003437587.1.22893 WP_003437587.1.22937 WP_003437587.1.23096 WP_003437587.1.23208 WP_003437587.1.23287 WP_003437587.1.23338 WP_003437587.1.2363 WP_003437587.1.24197 WP_003437587.1.24457 WP_003437587.1.24520 WP_003437587.1.24826 WP_003437587.1.24889 WP_003437587.1.24900 WP_003437587.1.24987 WP_003437587.1.25128 WP_003437587.1.25416 WP_003437587.1.25761 WP_003437587.1.26024 WP_003437587.1.26044 WP_003437587.1.26358 WP_003437587.1.26482 WP_003437587.1.26494 WP_003437587.1.26697 WP_003437587.1.26829 WP_003437587.1.26940 WP_003437587.1.27563 WP_003437587.1.2758 WP_003437587.1.27677 WP_003437587.1.27708 WP_003437587.1.27824 WP_003437587.1.27872 WP_003437587.1.27881 WP_003437587.1.27890 WP_003437587.1.27967 WP_003437587.1.27989 WP_003437587.1.27996 WP_003437587.1.28055 WP_003437587.1.28410 WP_003437587.1.28638 WP_003437587.1.28715 WP_003437587.1.28856 WP_003437587.1.28882 WP_003437587.1.28890 WP_003437587.1.28930 WP_003437587.1.2923 WP_003437587.1.293 WP_003437587.1.29600 WP_003437587.1.29757 WP_003437587.1.2982 WP_003437587.1.29891 WP_003437587.1.3024 WP_003437587.1.303 WP_003437587.1.3031 WP_003437587.1.30420 WP_003437587.1.30431 WP_003437587.1.30463 WP_003437587.1.30519 WP_003437587.1.30521 WP_003437587.1.30743 WP_003437587.1.30841 WP_003437587.1.30953 WP_003437587.1.31160 WP_003437587.1.31183 WP_003437587.1.31203 WP_003437587.1.31292 WP_003437587.1.31309 WP_003437587.1.31385 WP_003437587.1.31453 WP_003437587.1.31475 WP_003437587.1.31477 WP_003437587.1.31519 WP_003437587.1.31637 WP_003437587.1.31719 WP_003437587.1.31742 WP_003437587.1.31960 WP_003437587.1.31969 WP_003437587.1.32008 WP_003437587.1.32066 WP_003437587.1.32119 WP_003437587.1.32166 WP_003437587.1.32197 WP_003437587.1.32218 WP_003437587.1.32230 WP_003437587.1.32294 WP_003437587.1.32699 WP_003437587.1.32769 WP_003437587.1.32776 WP_003437587.1.32842 WP_003437587.1.33056 WP_003437587.1.33098 WP_003437587.1.33164 WP_003437587.1.33298 WP_003437587.1.33332 WP_003437587.1.33349 WP_003437587.1.3340 WP_003437587.1.33514 WP_003437587.1.33810 WP_003437587.1.34388 WP_003437587.1.34489 WP_003437587.1.34545 WP_003437587.1.34641 WP_003437587.1.34800 WP_003437587.1.34985 WP_003437587.1.34989 WP_003437587.1.35 WP_003437587.1.35002 WP_003437587.1.35137 WP_003437587.1.35181 WP_003437587.1.35234 WP_003437587.1.3559 WP_003437587.1.35709 WP_003437587.1.35832 WP_003437587.1.35884 WP_003437587.1.36078 WP_003437587.1.36257 WP_003437587.1.36338 WP_003437587.1.36738 WP_003437587.1.36835 WP_003437587.1.37255 WP_003437587.1.374 WP_003437587.1.37493 WP_003437587.1.37532 WP_003437587.1.37597 WP_003437587.1.37861 WP_003437587.1.3789 WP_003437587.1.37957 WP_003437587.1.37981 WP_003437587.1.38305 WP_003437587.1.38338 WP_003437587.1.38692 WP_003437587.1.38775 WP_003437587.1.38814 WP_003437587.1.38874 WP_003437587.1.38924 WP_003437587.1.38986 WP_003437587.1.3913 WP_003437587.1.39213 WP_003437587.1.39350 WP_003437587.1.39382 WP_003437587.1.39442 WP_003437587.1.39525 WP_003437587.1.39621 WP_003437587.1.39783 WP_003437587.1.39874 WP_003437587.1.39876 WP_003437587.1.39975 WP_003437587.1.39981 WP_003437587.1.40030 WP_003437587.1.40294 WP_003437587.1.40313 WP_003437587.1.40447 WP_003437587.1.40522 WP_003437587.1.40557 WP_003437587.1.407 WP_003437587.1.40775 WP_003437587.1.40891 WP_003437587.1.40959 WP_003437587.1.40966 WP_003437587.1.41131 WP_003437587.1.4121 WP_003437587.1.41334 WP_003437587.1.41342 WP_003437587.1.4137 WP_003437587.1.41506 WP_003437587.1.41534 WP_003437587.1.41641 WP_003437587.1.41687 WP_003437587.1.41818 WP_003437587.1.41995 WP_003437587.1.42035 WP_003437587.1.4204 WP_003437587.1.42066 WP_003437587.1.42532 WP_003437587.1.42533 WP_003437587.1.42610 WP_003437587.1.42664 WP_003437587.1.43112 WP_003437587.1.4315 WP_003437587.1.4321 WP_003437587.1.43388 WP_003437587.1.43490 WP_003437587.1.43519 WP_003437587.1.43579 WP_003437587.1.43824 WP_003437587.1.4383 WP_003437587.1.44030 WP_003437587.1.44105 WP_003437587.1.44149 WP_003437587.1.44198 WP_003437587.1.44241 WP_003437587.1.44470 WP_003437587.1.44471 WP_003437587.1.44729 WP_003437587.1.45017 WP_003437587.1.45059 WP_003437587.1.45142 WP_003437587.1.45165 WP_003437587.1.45209 WP_003437587.1.45257 WP_003437587.1.45352 WP_003437587.1.45554 WP_003437587.1.4573 WP_003437587.1.45938 WP_003437587.1.45986 WP_003437587.1.46066 WP_003437587.1.46274 WP_003437587.1.46280 WP_003437587.1.46305 WP_003437587.1.46522 WP_003437587.1.4698 WP_003437587.1.47016 WP_003437587.1.47173 WP_003437587.1.47227 WP_003437587.1.47228 WP_003437587.1.47479 WP_003437587.1.47615 WP_003437587.1.47708 WP_003437587.1.47729 WP_003437587.1.47940 WP_003437587.1.48220 WP_003437587.1.48246 WP_003437587.1.48279 WP_003437587.1.4835 WP_003437587.1.48733 WP_003437587.1.48746 WP_003437587.1.48772 WP_003437587.1.48935 WP_003437587.1.48980 WP_003437587.1.48983 WP_003437587.1.48991 WP_003437587.1.49020 WP_003437587.1.49054 WP_003437587.1.49065 WP_003437587.1.4908 WP_003437587.1.49092 WP_003437587.1.49230 WP_003437587.1.49310 WP_003437587.1.49339 WP_003437587.1.4948 WP_003437587.1.49633 WP_003437587.1.50159 WP_003437587.1.50341 WP_003437587.1.50460 WP_003437587.1.5073 WP_003437587.1.50865 WP_003437587.1.51007 WP_003437587.1.51235 WP_003437587.1.51675 WP_003437587.1.5187 WP_003437587.1.51996 WP_003437587.1.52073 WP_003437587.1.52266 WP_003437587.1.52278 WP_003437587.1.52294 WP_003437587.1.52311 WP_003437587.1.52330 WP_003437587.1.52383 WP_003437587.1.52402 WP_003437587.1.52466 WP_003437587.1.52525 WP_003437587.1.52789 WP_003437587.1.52958 WP_003437587.1.52997 WP_003437587.1.53008 WP_003437587.1.53044 WP_003437587.1.53055 WP_003437587.1.5337 WP_003437587.1.53504 WP_003437587.1.53704 WP_003437587.1.53710 WP_003437587.1.53729 WP_003437587.1.53987 WP_003437587.1.54058 WP_003437587.1.54153 WP_003437587.1.5423 WP_003437587.1.54262 WP_003437587.1.54350 WP_003437587.1.54586 WP_003437587.1.54593 WP_003437587.1.54692 WP_003437587.1.55055 WP_003437587.1.55101 WP_003437587.1.5521 WP_003437587.1.55302 WP_003437587.1.55371 WP_003437587.1.55391 WP_003437587.1.5558 WP_003437587.1.559 WP_003437587.1.56006 WP_003437587.1.56217 WP_003437587.1.56252 WP_003437587.1.56323 WP_003437587.1.56337 WP_003437587.1.56556 WP_003437587.1.5657 WP_003437587.1.5664 WP_003437587.1.56664 WP_003437587.1.56711 WP_003437587.1.56754 WP_003437587.1.56927 WP_003437587.1.56998 WP_003437587.1.57099 WP_003437587.1.57337 WP_003437587.1.5750 WP_003437587.1.57711 WP_003437587.1.57827 WP_003437587.1.58015 WP_003437587.1.58216 WP_003437587.1.58304 WP_003437587.1.58315 WP_003437587.1.58323 WP_003437587.1.58463 WP_003437587.1.58531 WP_003437587.1.58665 WP_003437587.1.58677 WP_003437587.1.58711 WP_003437587.1.58818 WP_003437587.1.58956 WP_003437587.1.5905 WP_003437587.1.59588 WP_003437587.1.59618 WP_003437587.1.59628 WP_003437587.1.59707 WP_003437587.1.59752 WP_003437587.1.59990 WP_003437587.1.60040 WP_003437587.1.6031 WP_003437587.1.60482 WP_003437587.1.60563 WP_003437587.1.6070 WP_003437587.1.60957 WP_003437587.1.60998 WP_003437587.1.61042 WP_003437587.1.61140 WP_003437587.1.61293 WP_003437587.1.61492 WP_003437587.1.61679 WP_003437587.1.61716 WP_003437587.1.61866 WP_003437587.1.61972 WP_003437587.1.62049 WP_003437587.1.62095 WP_003437587.1.62128 WP_003437587.1.62340 WP_003437587.1.62577 WP_003437587.1.62624 WP_003437587.1.62637 WP_003437587.1.62941 WP_003437587.1.62986 WP_003437587.1.63020 WP_003437587.1.63059 WP_003437587.1.63237 WP_003437587.1.63239 WP_003437587.1.63248 WP_003437587.1.63343 WP_003437587.1.63378 WP_003437587.1.63516 WP_003437587.1.63570 WP_003437587.1.63581 WP_003437587.1.63598 WP_003437587.1.63599 WP_003437587.1.63696 WP_003437587.1.63804 WP_003437587.1.63853 WP_003437587.1.63950 WP_003437587.1.64020 WP_003437587.1.64092 WP_003437587.1.64197 WP_003437587.1.64369 WP_003437587.1.64447 WP_003437587.1.64546 WP_003437587.1.64573 WP_003437587.1.64859 WP_003437587.1.65064 WP_003437587.1.65067 WP_003437587.1.65313 WP_003437587.1.65369 WP_003437587.1.65889 WP_003437587.1.66084 WP_003437587.1.66119 WP_003437587.1.66237 WP_003437587.1.66439 WP_003437587.1.66474 WP_003437587.1.66565 WP_003437587.1.66587 WP_003437587.1.66643 WP_003437587.1.66701 WP_003437587.1.6671 WP_003437587.1.6675 WP_003437587.1.66805 WP_003437587.1.66847 WP_003437587.1.6685 WP_003437587.1.66887 WP_003437587.1.66888 WP_003437587.1.66900 WP_003437587.1.670 WP_003437587.1.67303 WP_003437587.1.67308 WP_003437587.1.6736 WP_003437587.1.67368 WP_003437587.1.67528 WP_003437587.1.67689 WP_003437587.1.67695 WP_003437587.1.67711 WP_003437587.1.6792 WP_003437587.1.67951 WP_003437587.1.68150 WP_003437587.1.68276 WP_003437587.1.68322 WP_003437587.1.68955 WP_003437587.1.6898 WP_003437587.1.68980 WP_003437587.1.69114 WP_003437587.1.692 WP_003437587.1.69220 WP_003437587.1.69333 WP_003437587.1.69495 WP_003437587.1.69708 WP_003437587.1.6994 WP_003437587.1.700 WP_003437587.1.70152 WP_003437587.1.70179 WP_003437587.1.70231 WP_003437587.1.70320 WP_003437587.1.70695 WP_003437587.1.70710 WP_003437587.1.70820 WP_003437587.1.70886 WP_003437587.1.71079 WP_003437587.1.71119 WP_003437587.1.713 WP_003437587.1.71384 WP_003437587.1.71477 WP_003437587.1.7156 WP_003437587.1.71745 WP_003437587.1.7199 WP_003437587.1.72113 WP_003437587.1.72245 WP_003437587.1.72468 WP_003437587.1.72483 WP_003437587.1.72560 WP_003437587.1.72681 WP_003437587.1.72682 WP_003437587.1.72891 WP_003437587.1.72909 WP_003437587.1.72914 WP_003437587.1.72994 WP_003437587.1.73026 WP_003437587.1.73116 WP_003437587.1.7322 WP_003437587.1.73605 WP_003437587.1.73836 WP_003437587.1.73852 WP_003437587.1.73931 WP_003437587.1.74050 WP_003437587.1.74116 WP_003437587.1.74126 WP_003437587.1.74672 WP_003437587.1.74678 WP_003437587.1.74680 WP_003437587.1.74779 WP_003437587.1.74835 WP_003437587.1.74897 WP_003437587.1.75026 WP_003437587.1.751 WP_003437587.1.75210 WP_003437587.1.75226 WP_003437587.1.75287 WP_003437587.1.75454 WP_003437587.1.75638 WP_003437587.1.75659 WP_003437587.1.76207 WP_003437587.1.7650 WP_003437587.1.76550 WP_003437587.1.76552 WP_003437587.1.76603 WP_003437587.1.76621 WP_003437587.1.76664 WP_003437587.1.76687 WP_003437587.1.76793 WP_003437587.1.76813 WP_003437587.1.76882 WP_003437587.1.76924 WP_003437587.1.7696 WP_003437587.1.77092 WP_003437587.1.77102 WP_003437587.1.77473 WP_003437587.1.77509 WP_003437587.1.77544 WP_003437587.1.7755 WP_003437587.1.77639 WP_003437587.1.77782 WP_003437587.1.77842 WP_003437587.1.77942 WP_003437587.1.78123 WP_003437587.1.78579 WP_003437587.1.78949 WP_003437587.1.7916 WP_003437587.1.79199 WP_003437587.1.79221 WP_003437587.1.79309 WP_003437587.1.79344 WP_003437587.1.79437 WP_003437587.1.79611 WP_003437587.1.79680 WP_003437587.1.79703 WP_003437587.1.79836 WP_003437587.1.79956 WP_003437587.1.80052 WP_003437587.1.80144 WP_003437587.1.80342 WP_003437587.1.80379 WP_003437587.1.80455 WP_003437587.1.80504 WP_003437587.1.80575 WP_003437587.1.80963 WP_003437587.1.81035 WP_003437587.1.81044 WP_003437587.1.81208 WP_003437587.1.81299 WP_003437587.1.81351 WP_003437587.1.81402 WP_003437587.1.81605 WP_003437587.1.81777 WP_003437587.1.82002 WP_003437587.1.82084 WP_003437587.1.82150 WP_003437587.1.82169 WP_003437587.1.82335 WP_003437587.1.82635 WP_003437587.1.82701 WP_003437587.1.82920 WP_003437587.1.8314 WP_003437587.1.83148 WP_003437587.1.83175 WP_003437587.1.83255 WP_003437587.1.83287 WP_003437587.1.83288 WP_003437587.1.83318 WP_003437587.1.83348 WP_003437587.1.8336 WP_003437587.1.834 WP_003437587.1.83477 WP_003437587.1.83515 WP_003437587.1.83822 WP_003437587.1.83918 WP_003437587.1.84253 WP_003437587.1.84528 WP_003437587.1.84646 WP_003437587.1.84843 WP_003437587.1.84880 WP_003437587.1.84923 WP_003437587.1.85020 WP_003437587.1.85127 WP_003437587.1.85214 WP_003437587.1.85219 WP_003437587.1.8527 WP_003437587.1.85420 WP_003437587.1.85454 WP_003437587.1.85776 WP_003437587.1.85863 WP_003437587.1.8587 WP_003437587.1.85874 WP_003437587.1.85932 WP_003437587.1.86008 WP_003437587.1.86011 WP_003437587.1.86049 WP_003437587.1.86088 WP_003437587.1.86094 WP_003437587.1.86116 WP_003437587.1.86117 WP_003437587.1.86328 WP_003437587.1.86395 WP_003437587.1.86534 WP_003437587.1.86618 WP_003437587.1.86743 WP_003437587.1.86767 WP_003437587.1.86837 WP_003437587.1.86914 WP_003437587.1.87058 WP_003437587.1.87195 WP_003437587.1.87326 WP_003437587.1.87454 WP_003437587.1.87714 WP_003437587.1.87723 WP_003437587.1.87730 WP_003437587.1.87918 WP_003437587.1.87932 WP_003437587.1.88091 WP_003437587.1.882 WP_003437587.1.88268 WP_003437587.1.88332 WP_003437587.1.88364 WP_003437587.1.88372 WP_003437587.1.88377 WP_003437587.1.88608 WP_003437587.1.88640 WP_003437587.1.88996 WP_003437587.1.89052 WP_003437587.1.89065 WP_003437587.1.89337 WP_003437587.1.89364 WP_003437587.1.89457 WP_003437587.1.89541 WP_003437587.1.89629 WP_003437587.1.89697 WP_003437587.1.8984 WP_003437587.1.89994 WP_003437587.1.90076 WP_003437587.1.90101 WP_003437587.1.90164 WP_003437587.1.90329 WP_003437587.1.9041 WP_003437587.1.90491 WP_003437587.1.90555 WP_003437587.1.90643 WP_003437587.1.9083 WP_003437587.1.90921 WP_003437587.1.90938 WP_003437587.1.90985 WP_003437587.1.91065 WP_003437587.1.91254 WP_003437587.1.91314 WP_003437587.1.91406 WP_003437587.1.91570 WP_003437587.1.91648 WP_003437587.1.92075 WP_003437587.1.92284 WP_003437587.1.92371 WP_003437587.1.92576 WP_003437587.1.92658 WP_003437587.1.92697 WP_003437587.1.92941 WP_003437587.1.93044 WP_003437587.1.93171 WP_003437587.1.93313 WP_003437587.1.93360 WP_003437587.1.93480 WP_003437587.1.93615 WP_003437587.1.93687 WP_003437587.1.93717 WP_003437587.1.93782 WP_003437587.1.93798 WP_003437587.1.93802 WP_003437587.1.93830 WP_003437587.1.9393 WP_003437587.1.93968 WP_003437587.1.94067 WP_003437587.1.94073 WP_003437587.1.94166 WP_003437587.1.94427 WP_003437587.1.94768 WP_003437587.1.94831 WP_003437587.1.94968 WP_003437587.1.95095 WP_003437587.1.95173 WP_003437587.1.9522 WP_003437587.1.95350 WP_003437587.1.95517 WP_003437587.1.9580 WP_003437587.1.95847 WP_003437587.1.95893 WP_003437587.1.96113 WP_003437587.1.9635 WP_003437587.1.96503 WP_003437587.1.96505 WP_003437587.1.9666 WP_003437587.1.96690 WP_003437587.1.96765 WP_003437587.1.97219 WP_003437587.1.97458 WP_003437587.1.97672 WP_003437587.1.97682 WP_003437587.1.97806 WP_003437587.1.98037 WP_003437587.1.98514 WP_003437587.1.98622 WP_003437587.1.98698 WP_003437587.1.98715 WP_003437587.1.98748 WP_003437587.1.98856 WP_003437587.1.98913 WP_003437587.1.98997 WP_003437587.1.99064 WP_003437587.1.99134 WP_003437587.1.99333 WP_003437587.1.99542 WP_003437587.1.99545 WP_003437587.1.99731 WP_003437587.1.9986 YP_001086781.1.32744 272563.CD0312 645462.CD196_0330 645463.CDR20291_0317 gi|126697884|ref|YP_001086781.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]