SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260682188|ref|YP_003213473.1| from Clostridium difficile CD196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260682188|ref|YP_003213473.1|
Domain Number 1 Region: 5-122
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.62e-35
Family Penicillinase repressor 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|260682188|ref|YP_003213473.1|
Sequence length 128
Comment penicillinase repressor [Clostridium difficile CD196]
Sequence
MKKLPHISEAEYQVMKIIWKYAPISTTEVIEKLVETSTWSPKTIQTMLLRLVKKGALTYE
KNSRVFVYTPLVKEEEYVATESSSFLNRFYNGTLNSMVLNFLENDKLSEDDIEELREILN
KRTTKGDK
Download sequence
Identical sequences A0A0H3MZZ9 A0A0J0UFF3 A0A1F2DI38 A0A1M2YFL0 A0A2I2JNS8 C9YIL9 D5Q039 D5S3X6 Q188R8 U3UKY1 U3V400 U3VFG4
gi|384359755|ref|YP_006197607.1| WP_003417583.1.100055 WP_003417583.1.100097 WP_003417583.1.100107 WP_003417583.1.100118 WP_003417583.1.100139 WP_003417583.1.100513 WP_003417583.1.100570 WP_003417583.1.100660 WP_003417583.1.100831 WP_003417583.1.100923 WP_003417583.1.101035 WP_003417583.1.10130 WP_003417583.1.101316 WP_003417583.1.101861 WP_003417583.1.102031 WP_003417583.1.102074 WP_003417583.1.102095 WP_003417583.1.10488 WP_003417583.1.10582 WP_003417583.1.10691 WP_003417583.1.11025 WP_003417583.1.11278 WP_003417583.1.11372 WP_003417583.1.11398 WP_003417583.1.1167 WP_003417583.1.1179 WP_003417583.1.11954 WP_003417583.1.11959 WP_003417583.1.12066 WP_003417583.1.12169 WP_003417583.1.1254 WP_003417583.1.12632 WP_003417583.1.12659 WP_003417583.1.1273 WP_003417583.1.12807 WP_003417583.1.12809 WP_003417583.1.12953 WP_003417583.1.13040 WP_003417583.1.13251 WP_003417583.1.13398 WP_003417583.1.13418 WP_003417583.1.13823 WP_003417583.1.13841 WP_003417583.1.13859 WP_003417583.1.14045 WP_003417583.1.14170 WP_003417583.1.14205 WP_003417583.1.14352 WP_003417583.1.1445 WP_003417583.1.14483 WP_003417583.1.14579 WP_003417583.1.14674 WP_003417583.1.14698 WP_003417583.1.1494 WP_003417583.1.15083 WP_003417583.1.15097 WP_003417583.1.15192 WP_003417583.1.15908 WP_003417583.1.16376 WP_003417583.1.16520 WP_003417583.1.16728 WP_003417583.1.169 WP_003417583.1.16931 WP_003417583.1.16966 WP_003417583.1.1705 WP_003417583.1.17413 WP_003417583.1.17463 WP_003417583.1.17512 WP_003417583.1.17808 WP_003417583.1.17851 WP_003417583.1.17879 WP_003417583.1.17908 WP_003417583.1.17998 WP_003417583.1.18060 WP_003417583.1.18207 WP_003417583.1.18212 WP_003417583.1.18298 WP_003417583.1.18407 WP_003417583.1.18455 WP_003417583.1.18462 WP_003417583.1.18551 WP_003417583.1.18680 WP_003417583.1.19088 WP_003417583.1.19152 WP_003417583.1.1926 WP_003417583.1.19290 WP_003417583.1.1934 WP_003417583.1.19648 WP_003417583.1.19899 WP_003417583.1.19956 WP_003417583.1.1999 WP_003417583.1.20184 WP_003417583.1.20313 WP_003417583.1.20650 WP_003417583.1.20872 WP_003417583.1.20875 WP_003417583.1.21000 WP_003417583.1.21048 WP_003417583.1.21201 WP_003417583.1.21220 WP_003417583.1.21502 WP_003417583.1.21520 WP_003417583.1.21547 WP_003417583.1.21618 WP_003417583.1.21704 WP_003417583.1.21893 WP_003417583.1.21925 WP_003417583.1.21980 WP_003417583.1.22020 WP_003417583.1.22079 WP_003417583.1.22128 WP_003417583.1.22222 WP_003417583.1.22357 WP_003417583.1.22395 WP_003417583.1.22417 WP_003417583.1.22568 WP_003417583.1.22569 WP_003417583.1.22615 WP_003417583.1.22768 WP_003417583.1.22893 WP_003417583.1.22937 WP_003417583.1.23096 WP_003417583.1.23287 WP_003417583.1.2363 WP_003417583.1.24197 WP_003417583.1.24826 WP_003417583.1.24987 WP_003417583.1.25128 WP_003417583.1.25416 WP_003417583.1.26044 WP_003417583.1.26482 WP_003417583.1.26494 WP_003417583.1.26829 WP_003417583.1.27300 WP_003417583.1.27677 WP_003417583.1.27708 WP_003417583.1.27824 WP_003417583.1.27881 WP_003417583.1.27890 WP_003417583.1.27989 WP_003417583.1.27996 WP_003417583.1.28055 WP_003417583.1.28410 WP_003417583.1.28715 WP_003417583.1.28856 WP_003417583.1.28890 WP_003417583.1.2923 WP_003417583.1.293 WP_003417583.1.29600 WP_003417583.1.2982 WP_003417583.1.29891 WP_003417583.1.29939 WP_003417583.1.303 WP_003417583.1.3031 WP_003417583.1.30420 WP_003417583.1.30519 WP_003417583.1.30521 WP_003417583.1.30743 WP_003417583.1.30841 WP_003417583.1.30953 WP_003417583.1.31160 WP_003417583.1.31183 WP_003417583.1.31292 WP_003417583.1.31309 WP_003417583.1.31351 WP_003417583.1.31385 WP_003417583.1.31453 WP_003417583.1.31475 WP_003417583.1.31477 WP_003417583.1.31742 WP_003417583.1.31960 WP_003417583.1.32008 WP_003417583.1.32066 WP_003417583.1.32119 WP_003417583.1.32166 WP_003417583.1.32218 WP_003417583.1.32230 WP_003417583.1.32294 WP_003417583.1.32699 WP_003417583.1.32842 WP_003417583.1.32953 WP_003417583.1.33056 WP_003417583.1.33098 WP_003417583.1.33275 WP_003417583.1.33332 WP_003417583.1.33349 WP_003417583.1.33514 WP_003417583.1.34489 WP_003417583.1.34545 WP_003417583.1.34641 WP_003417583.1.34800 WP_003417583.1.34985 WP_003417583.1.35137 WP_003417583.1.35181 WP_003417583.1.35187 WP_003417583.1.35234 WP_003417583.1.3559 WP_003417583.1.35832 WP_003417583.1.35884 WP_003417583.1.36078 WP_003417583.1.36257 WP_003417583.1.36338 WP_003417583.1.36738 WP_003417583.1.36835 WP_003417583.1.37255 WP_003417583.1.374 WP_003417583.1.37532 WP_003417583.1.37597 WP_003417583.1.37861 WP_003417583.1.37957 WP_003417583.1.38692 WP_003417583.1.38775 WP_003417583.1.38874 WP_003417583.1.38924 WP_003417583.1.38986 WP_003417583.1.3913 WP_003417583.1.39350 WP_003417583.1.39382 WP_003417583.1.39442 WP_003417583.1.39525 WP_003417583.1.39876 WP_003417583.1.39975 WP_003417583.1.39981 WP_003417583.1.40030 WP_003417583.1.40294 WP_003417583.1.40313 WP_003417583.1.40447 WP_003417583.1.40516 WP_003417583.1.40522 WP_003417583.1.40557 WP_003417583.1.407 WP_003417583.1.40891 WP_003417583.1.40959 WP_003417583.1.40966 WP_003417583.1.4121 WP_003417583.1.41342 WP_003417583.1.4137 WP_003417583.1.41534 WP_003417583.1.41641 WP_003417583.1.41687 WP_003417583.1.41818 WP_003417583.1.41995 WP_003417583.1.42035 WP_003417583.1.4204 WP_003417583.1.42532 WP_003417583.1.42533 WP_003417583.1.42610 WP_003417583.1.42664 WP_003417583.1.4315 WP_003417583.1.43388 WP_003417583.1.43490 WP_003417583.1.43519 WP_003417583.1.43579 WP_003417583.1.43824 WP_003417583.1.44030 WP_003417583.1.44105 WP_003417583.1.44198 WP_003417583.1.44241 WP_003417583.1.44470 WP_003417583.1.44471 WP_003417583.1.44729 WP_003417583.1.45017 WP_003417583.1.45059 WP_003417583.1.45165 WP_003417583.1.45209 WP_003417583.1.45257 WP_003417583.1.45352 WP_003417583.1.45554 WP_003417583.1.4573 WP_003417583.1.45986 WP_003417583.1.46066 WP_003417583.1.46117 WP_003417583.1.46274 WP_003417583.1.46280 WP_003417583.1.46305 WP_003417583.1.46522 WP_003417583.1.4698 WP_003417583.1.47016 WP_003417583.1.47173 WP_003417583.1.47227 WP_003417583.1.47228 WP_003417583.1.47708 WP_003417583.1.47729 WP_003417583.1.48279 WP_003417583.1.4835 WP_003417583.1.48491 WP_003417583.1.48746 WP_003417583.1.48935 WP_003417583.1.48983 WP_003417583.1.49020 WP_003417583.1.49054 WP_003417583.1.49092 WP_003417583.1.49230 WP_003417583.1.49451 WP_003417583.1.4948 WP_003417583.1.49633 WP_003417583.1.50341 WP_003417583.1.50460 WP_003417583.1.50495 WP_003417583.1.5073 WP_003417583.1.50865 WP_003417583.1.51007 WP_003417583.1.51166 WP_003417583.1.51235 WP_003417583.1.5187 WP_003417583.1.51996 WP_003417583.1.52164 WP_003417583.1.52278 WP_003417583.1.52294 WP_003417583.1.52311 WP_003417583.1.52330 WP_003417583.1.52383 WP_003417583.1.52466 WP_003417583.1.52525 WP_003417583.1.52789 WP_003417583.1.52958 WP_003417583.1.52997 WP_003417583.1.53044 WP_003417583.1.53288 WP_003417583.1.5337 WP_003417583.1.53504 WP_003417583.1.53704 WP_003417583.1.53710 WP_003417583.1.53729 WP_003417583.1.54058 WP_003417583.1.54153 WP_003417583.1.5423 WP_003417583.1.54262 WP_003417583.1.54593 WP_003417583.1.54692 WP_003417583.1.55055 WP_003417583.1.55101 WP_003417583.1.55302 WP_003417583.1.55371 WP_003417583.1.559 WP_003417583.1.56252 WP_003417583.1.56323 WP_003417583.1.5657 WP_003417583.1.5664 WP_003417583.1.56664 WP_003417583.1.56711 WP_003417583.1.56754 WP_003417583.1.56927 WP_003417583.1.56998 WP_003417583.1.57711 WP_003417583.1.57827 WP_003417583.1.58015 WP_003417583.1.58216 WP_003417583.1.58304 WP_003417583.1.58323 WP_003417583.1.58463 WP_003417583.1.58665 WP_003417583.1.58677 WP_003417583.1.58956 WP_003417583.1.5905 WP_003417583.1.59588 WP_003417583.1.59707 WP_003417583.1.6031 WP_003417583.1.6070 WP_003417583.1.60998 WP_003417583.1.61293 WP_003417583.1.61492 WP_003417583.1.61679 WP_003417583.1.61716 WP_003417583.1.61972 WP_003417583.1.62128 WP_003417583.1.62577 WP_003417583.1.62624 WP_003417583.1.62637 WP_003417583.1.62797 WP_003417583.1.62941 WP_003417583.1.63059 WP_003417583.1.63239 WP_003417583.1.63248 WP_003417583.1.63343 WP_003417583.1.63378 WP_003417583.1.63581 WP_003417583.1.63598 WP_003417583.1.63599 WP_003417583.1.63696 WP_003417583.1.63852 WP_003417583.1.63853 WP_003417583.1.64020 WP_003417583.1.64197 WP_003417583.1.64369 WP_003417583.1.64447 WP_003417583.1.64859 WP_003417583.1.65064 WP_003417583.1.65067 WP_003417583.1.65889 WP_003417583.1.66084 WP_003417583.1.66119 WP_003417583.1.66237 WP_003417583.1.66474 WP_003417583.1.66565 WP_003417583.1.66608 WP_003417583.1.66643 WP_003417583.1.66701 WP_003417583.1.6675 WP_003417583.1.66847 WP_003417583.1.6685 WP_003417583.1.66887 WP_003417583.1.66888 WP_003417583.1.66900 WP_003417583.1.670 WP_003417583.1.67303 WP_003417583.1.67308 WP_003417583.1.6736 WP_003417583.1.67368 WP_003417583.1.67528 WP_003417583.1.67689 WP_003417583.1.6792 WP_003417583.1.68955 WP_003417583.1.6898 WP_003417583.1.68980 WP_003417583.1.69114 WP_003417583.1.692 WP_003417583.1.69220 WP_003417583.1.69333 WP_003417583.1.69495 WP_003417583.1.700 WP_003417583.1.70152 WP_003417583.1.70231 WP_003417583.1.70320 WP_003417583.1.70464 WP_003417583.1.70886 WP_003417583.1.71119 WP_003417583.1.713 WP_003417583.1.7156 WP_003417583.1.71745 WP_003417583.1.72245 WP_003417583.1.72468 WP_003417583.1.72483 WP_003417583.1.72560 WP_003417583.1.72681 WP_003417583.1.72682 WP_003417583.1.72891 WP_003417583.1.72909 WP_003417583.1.72914 WP_003417583.1.72994 WP_003417583.1.73026 WP_003417583.1.73116 WP_003417583.1.7322 WP_003417583.1.73852 WP_003417583.1.73931 WP_003417583.1.74116 WP_003417583.1.74678 WP_003417583.1.74680 WP_003417583.1.74835 WP_003417583.1.74897 WP_003417583.1.751 WP_003417583.1.75210 WP_003417583.1.75638 WP_003417583.1.76207 WP_003417583.1.7650 WP_003417583.1.76552 WP_003417583.1.76603 WP_003417583.1.76621 WP_003417583.1.76687 WP_003417583.1.76793 WP_003417583.1.76813 WP_003417583.1.76882 WP_003417583.1.7696 WP_003417583.1.77102 WP_003417583.1.77473 WP_003417583.1.77544 WP_003417583.1.7755 WP_003417583.1.77639 WP_003417583.1.77782 WP_003417583.1.77842 WP_003417583.1.77942 WP_003417583.1.78123 WP_003417583.1.78579 WP_003417583.1.78949 WP_003417583.1.79125 WP_003417583.1.79199 WP_003417583.1.79221 WP_003417583.1.79309 WP_003417583.1.79344 WP_003417583.1.79611 WP_003417583.1.79673 WP_003417583.1.79680 WP_003417583.1.79703 WP_003417583.1.79836 WP_003417583.1.80144 WP_003417583.1.80342 WP_003417583.1.80379 WP_003417583.1.80504 WP_003417583.1.80575 WP_003417583.1.80610 WP_003417583.1.80963 WP_003417583.1.81044 WP_003417583.1.81208 WP_003417583.1.81299 WP_003417583.1.81351 WP_003417583.1.81402 WP_003417583.1.81605 WP_003417583.1.82002 WP_003417583.1.82084 WP_003417583.1.82335 WP_003417583.1.82635 WP_003417583.1.83148 WP_003417583.1.83175 WP_003417583.1.83255 WP_003417583.1.83288 WP_003417583.1.83348 WP_003417583.1.834 WP_003417583.1.83477 WP_003417583.1.83515 WP_003417583.1.83641 WP_003417583.1.83822 WP_003417583.1.84195 WP_003417583.1.84253 WP_003417583.1.84606 WP_003417583.1.84646 WP_003417583.1.84843 WP_003417583.1.84880 WP_003417583.1.85020 WP_003417583.1.85127 WP_003417583.1.85214 WP_003417583.1.85219 WP_003417583.1.8527 WP_003417583.1.85454 WP_003417583.1.85874 WP_003417583.1.85932 WP_003417583.1.86008 WP_003417583.1.86094 WP_003417583.1.86117 WP_003417583.1.86328 WP_003417583.1.86395 WP_003417583.1.86534 WP_003417583.1.86914 WP_003417583.1.87058 WP_003417583.1.87195 WP_003417583.1.87326 WP_003417583.1.87454 WP_003417583.1.87723 WP_003417583.1.87730 WP_003417583.1.87918 WP_003417583.1.87932 WP_003417583.1.88268 WP_003417583.1.88332 WP_003417583.1.88364 WP_003417583.1.88372 WP_003417583.1.88377 WP_003417583.1.88608 WP_003417583.1.89052 WP_003417583.1.89065 WP_003417583.1.89196 WP_003417583.1.89337 WP_003417583.1.89457 WP_003417583.1.89541 WP_003417583.1.89629 WP_003417583.1.89697 WP_003417583.1.89994 WP_003417583.1.90076 WP_003417583.1.90101 WP_003417583.1.90164 WP_003417583.1.90329 WP_003417583.1.9041 WP_003417583.1.90491 WP_003417583.1.90643 WP_003417583.1.9083 WP_003417583.1.90921 WP_003417583.1.90938 WP_003417583.1.90981 WP_003417583.1.91065 WP_003417583.1.91254 WP_003417583.1.91406 WP_003417583.1.92075 WP_003417583.1.92576 WP_003417583.1.92658 WP_003417583.1.92697 WP_003417583.1.92941 WP_003417583.1.93044 WP_003417583.1.93171 WP_003417583.1.93313 WP_003417583.1.93360 WP_003417583.1.93615 WP_003417583.1.93687 WP_003417583.1.93766 WP_003417583.1.93798 WP_003417583.1.93830 WP_003417583.1.9393 WP_003417583.1.94067 WP_003417583.1.94166 WP_003417583.1.94427 WP_003417583.1.94768 WP_003417583.1.95173 WP_003417583.1.9522 WP_003417583.1.95350 WP_003417583.1.95517 WP_003417583.1.95847 WP_003417583.1.95893 WP_003417583.1.9635 WP_003417583.1.9666 WP_003417583.1.96765 WP_003417583.1.97219 WP_003417583.1.97432 WP_003417583.1.97458 WP_003417583.1.97672 WP_003417583.1.97682 WP_003417583.1.97806 WP_003417583.1.98037 WP_003417583.1.98622 WP_003417583.1.98748 WP_003417583.1.98856 WP_003417583.1.99064 WP_003417583.1.99134 WP_003417583.1.99333 WP_003417583.1.99542 WP_003417583.1.99731 WP_003417583.1.9986 YP_001086944.1.32744 gi|260682188|ref|YP_003213473.1| 272563.CD0471 645462.CD196_0427 645463.CDR20291_0413 gi|126698047|ref|YP_001086944.1| gi|260685787|ref|YP_003216920.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]