SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260682190|ref|YP_003213475.1| from Clostridium difficile CD196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260682190|ref|YP_003213475.1|
Domain Number 1 Region: 11-139
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.05e-27
Family MarR-like transcriptional regulators 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|260682190|ref|YP_003213475.1|
Sequence length 141
Comment MarR family transcriptional regulator [Clostridium difficile CD196]
Sequence
MKDFEKLYEATTKLVSTSLKVKDDLKKMFKQNGYDITTDHYALLRFLWEQDGISQIDLCE
KSCKDKSNTTRILDVMKNKGLIVRKVDVKDRRKFQIFLTDLGRELEEPLNEIASIYATET
FKSISDEELPLFTDILDRIGK
Download sequence
Identical sequences A0A0H3N3U9 A0A2A3KCA6 C9YIM1 Q188R6 T4IBA9
272563.CD0473 645462.CD196_0429 645463.CDR20291_0415 gi|260685789|ref|YP_003216922.1| WP_011860828.1.100055 WP_011860828.1.100097 WP_011860828.1.100107 WP_011860828.1.100118 WP_011860828.1.100139 WP_011860828.1.100513 WP_011860828.1.100570 WP_011860828.1.100660 WP_011860828.1.101035 WP_011860828.1.10130 WP_011860828.1.101316 WP_011860828.1.101532 WP_011860828.1.101861 WP_011860828.1.102031 WP_011860828.1.102074 WP_011860828.1.102095 WP_011860828.1.10483 WP_011860828.1.10488 WP_011860828.1.10691 WP_011860828.1.10793 WP_011860828.1.10795 WP_011860828.1.11025 WP_011860828.1.11224 WP_011860828.1.11278 WP_011860828.1.11320 WP_011860828.1.11398 WP_011860828.1.1167 WP_011860828.1.1179 WP_011860828.1.11937 WP_011860828.1.11959 WP_011860828.1.12066 WP_011860828.1.12169 WP_011860828.1.12385 WP_011860828.1.1254 WP_011860828.1.12629 WP_011860828.1.12632 WP_011860828.1.12659 WP_011860828.1.1273 WP_011860828.1.12734 WP_011860828.1.12807 WP_011860828.1.12809 WP_011860828.1.13040 WP_011860828.1.13251 WP_011860828.1.13273 WP_011860828.1.13398 WP_011860828.1.13418 WP_011860828.1.13730 WP_011860828.1.13841 WP_011860828.1.13859 WP_011860828.1.14045 WP_011860828.1.141 WP_011860828.1.14170 WP_011860828.1.14177 WP_011860828.1.14205 WP_011860828.1.1422 WP_011860828.1.14259 WP_011860828.1.14330 WP_011860828.1.14352 WP_011860828.1.1445 WP_011860828.1.14457 WP_011860828.1.14483 WP_011860828.1.14579 WP_011860828.1.14674 WP_011860828.1.14686 WP_011860828.1.14698 WP_011860828.1.14848 WP_011860828.1.1494 WP_011860828.1.15083 WP_011860828.1.15097 WP_011860828.1.15192 WP_011860828.1.15205 WP_011860828.1.15435 WP_011860828.1.15908 WP_011860828.1.16012 WP_011860828.1.16135 WP_011860828.1.16185 WP_011860828.1.16376 WP_011860828.1.16520 WP_011860828.1.16728 WP_011860828.1.169 WP_011860828.1.16931 WP_011860828.1.16966 WP_011860828.1.1705 WP_011860828.1.17371 WP_011860828.1.17463 WP_011860828.1.17512 WP_011860828.1.17611 WP_011860828.1.17851 WP_011860828.1.17879 WP_011860828.1.17908 WP_011860828.1.17960 WP_011860828.1.18060 WP_011860828.1.18207 WP_011860828.1.18212 WP_011860828.1.18298 WP_011860828.1.1838 WP_011860828.1.18407 WP_011860828.1.18455 WP_011860828.1.18462 WP_011860828.1.18551 WP_011860828.1.18680 WP_011860828.1.18805 WP_011860828.1.18970 WP_011860828.1.19088 WP_011860828.1.19152 WP_011860828.1.1926 WP_011860828.1.19290 WP_011860828.1.1934 WP_011860828.1.19627 WP_011860828.1.19648 WP_011860828.1.19704 WP_011860828.1.19899 WP_011860828.1.19956 WP_011860828.1.1999 WP_011860828.1.2002 WP_011860828.1.20132 WP_011860828.1.20184 WP_011860828.1.20302 WP_011860828.1.20313 WP_011860828.1.20481 WP_011860828.1.20650 WP_011860828.1.20728 WP_011860828.1.20872 WP_011860828.1.20875 WP_011860828.1.20960 WP_011860828.1.21000 WP_011860828.1.21048 WP_011860828.1.21201 WP_011860828.1.21220 WP_011860828.1.21417 WP_011860828.1.21520 WP_011860828.1.21547 WP_011860828.1.21618 WP_011860828.1.21704 WP_011860828.1.21893 WP_011860828.1.22020 WP_011860828.1.22079 WP_011860828.1.22222 WP_011860828.1.22228 WP_011860828.1.22313 WP_011860828.1.22411 WP_011860828.1.22417 WP_011860828.1.22569 WP_011860828.1.22615 WP_011860828.1.22768 WP_011860828.1.22893 WP_011860828.1.22937 WP_011860828.1.23208 WP_011860828.1.23287 WP_011860828.1.23338 WP_011860828.1.2363 WP_011860828.1.24197 WP_011860828.1.24457 WP_011860828.1.24520 WP_011860828.1.24889 WP_011860828.1.24900 WP_011860828.1.25128 WP_011860828.1.25416 WP_011860828.1.25761 WP_011860828.1.26024 WP_011860828.1.26358 WP_011860828.1.26482 WP_011860828.1.26697 WP_011860828.1.26829 WP_011860828.1.26940 WP_011860828.1.27563 WP_011860828.1.27677 WP_011860828.1.27708 WP_011860828.1.27824 WP_011860828.1.27872 WP_011860828.1.27881 WP_011860828.1.27890 WP_011860828.1.27967 WP_011860828.1.27989 WP_011860828.1.27996 WP_011860828.1.28055 WP_011860828.1.28410 WP_011860828.1.28638 WP_011860828.1.28715 WP_011860828.1.28856 WP_011860828.1.28882 WP_011860828.1.28890 WP_011860828.1.28930 WP_011860828.1.2923 WP_011860828.1.29600 WP_011860828.1.29757 WP_011860828.1.2982 WP_011860828.1.29891 WP_011860828.1.3024 WP_011860828.1.303 WP_011860828.1.3031 WP_011860828.1.30420 WP_011860828.1.30431 WP_011860828.1.30463 WP_011860828.1.30519 WP_011860828.1.30521 WP_011860828.1.30743 WP_011860828.1.30841 WP_011860828.1.30953 WP_011860828.1.31160 WP_011860828.1.31183 WP_011860828.1.31203 WP_011860828.1.31292 WP_011860828.1.31309 WP_011860828.1.31351 WP_011860828.1.31385 WP_011860828.1.31453 WP_011860828.1.31475 WP_011860828.1.31477 WP_011860828.1.31519 WP_011860828.1.31637 WP_011860828.1.31719 WP_011860828.1.31742 WP_011860828.1.31960 WP_011860828.1.31969 WP_011860828.1.32008 WP_011860828.1.32066 WP_011860828.1.32119 WP_011860828.1.32166 WP_011860828.1.32197 WP_011860828.1.32218 WP_011860828.1.32230 WP_011860828.1.32294 WP_011860828.1.32699 WP_011860828.1.32769 WP_011860828.1.32776 WP_011860828.1.32842 WP_011860828.1.33056 WP_011860828.1.33098 WP_011860828.1.33164 WP_011860828.1.33298 WP_011860828.1.33332 WP_011860828.1.33349 WP_011860828.1.3340 WP_011860828.1.33514 WP_011860828.1.33810 WP_011860828.1.34388 WP_011860828.1.34489 WP_011860828.1.34545 WP_011860828.1.34641 WP_011860828.1.34800 WP_011860828.1.34985 WP_011860828.1.35 WP_011860828.1.35002 WP_011860828.1.35137 WP_011860828.1.35181 WP_011860828.1.35187 WP_011860828.1.35234 WP_011860828.1.3559 WP_011860828.1.35709 WP_011860828.1.35832 WP_011860828.1.35884 WP_011860828.1.36078 WP_011860828.1.36257 WP_011860828.1.36338 WP_011860828.1.36738 WP_011860828.1.36835 WP_011860828.1.37255 WP_011860828.1.374 WP_011860828.1.37493 WP_011860828.1.37532 WP_011860828.1.37597 WP_011860828.1.37861 WP_011860828.1.3789 WP_011860828.1.37957 WP_011860828.1.37981 WP_011860828.1.38305 WP_011860828.1.38338 WP_011860828.1.38692 WP_011860828.1.38775 WP_011860828.1.38814 WP_011860828.1.38874 WP_011860828.1.38986 WP_011860828.1.3913 WP_011860828.1.39213 WP_011860828.1.39350 WP_011860828.1.39382 WP_011860828.1.39442 WP_011860828.1.39525 WP_011860828.1.39621 WP_011860828.1.39783 WP_011860828.1.39874 WP_011860828.1.39876 WP_011860828.1.39975 WP_011860828.1.39981 WP_011860828.1.40030 WP_011860828.1.40294 WP_011860828.1.40313 WP_011860828.1.40447 WP_011860828.1.40522 WP_011860828.1.40557 WP_011860828.1.407 WP_011860828.1.40775 WP_011860828.1.40891 WP_011860828.1.40959 WP_011860828.1.40966 WP_011860828.1.41131 WP_011860828.1.4121 WP_011860828.1.41334 WP_011860828.1.41342 WP_011860828.1.4137 WP_011860828.1.41506 WP_011860828.1.41534 WP_011860828.1.41641 WP_011860828.1.41687 WP_011860828.1.41818 WP_011860828.1.41995 WP_011860828.1.42035 WP_011860828.1.4204 WP_011860828.1.42066 WP_011860828.1.42532 WP_011860828.1.42533 WP_011860828.1.42610 WP_011860828.1.42664 WP_011860828.1.43112 WP_011860828.1.4321 WP_011860828.1.43490 WP_011860828.1.43519 WP_011860828.1.43579 WP_011860828.1.43824 WP_011860828.1.4383 WP_011860828.1.44030 WP_011860828.1.44149 WP_011860828.1.44198 WP_011860828.1.44241 WP_011860828.1.44470 WP_011860828.1.44471 WP_011860828.1.44729 WP_011860828.1.45017 WP_011860828.1.45059 WP_011860828.1.45142 WP_011860828.1.45165 WP_011860828.1.45209 WP_011860828.1.45257 WP_011860828.1.45352 WP_011860828.1.45554 WP_011860828.1.4573 WP_011860828.1.45938 WP_011860828.1.45986 WP_011860828.1.46066 WP_011860828.1.46274 WP_011860828.1.46280 WP_011860828.1.46305 WP_011860828.1.46522 WP_011860828.1.4698 WP_011860828.1.47016 WP_011860828.1.47228 WP_011860828.1.47479 WP_011860828.1.47615 WP_011860828.1.47708 WP_011860828.1.47729 WP_011860828.1.47940 WP_011860828.1.48220 WP_011860828.1.48246 WP_011860828.1.48279 WP_011860828.1.4835 WP_011860828.1.48733 WP_011860828.1.48746 WP_011860828.1.48772 WP_011860828.1.48935 WP_011860828.1.48980 WP_011860828.1.48983 WP_011860828.1.48991 WP_011860828.1.49020 WP_011860828.1.49054 WP_011860828.1.49065 WP_011860828.1.4908 WP_011860828.1.49092 WP_011860828.1.49230 WP_011860828.1.49310 WP_011860828.1.4948 WP_011860828.1.49633 WP_011860828.1.50159 WP_011860828.1.50341 WP_011860828.1.5073 WP_011860828.1.50865 WP_011860828.1.51007 WP_011860828.1.51235 WP_011860828.1.51675 WP_011860828.1.51996 WP_011860828.1.52073 WP_011860828.1.52266 WP_011860828.1.52278 WP_011860828.1.52311 WP_011860828.1.52330 WP_011860828.1.52383 WP_011860828.1.52402 WP_011860828.1.52466 WP_011860828.1.52525 WP_011860828.1.52789 WP_011860828.1.52958 WP_011860828.1.52997 WP_011860828.1.53008 WP_011860828.1.53044 WP_011860828.1.53055 WP_011860828.1.5337 WP_011860828.1.53504 WP_011860828.1.53704 WP_011860828.1.53710 WP_011860828.1.53729 WP_011860828.1.53987 WP_011860828.1.54058 WP_011860828.1.54153 WP_011860828.1.5423 WP_011860828.1.54262 WP_011860828.1.54350 WP_011860828.1.54586 WP_011860828.1.54692 WP_011860828.1.55055 WP_011860828.1.55101 WP_011860828.1.5521 WP_011860828.1.55302 WP_011860828.1.55371 WP_011860828.1.55391 WP_011860828.1.5558 WP_011860828.1.559 WP_011860828.1.56006 WP_011860828.1.56252 WP_011860828.1.56323 WP_011860828.1.56337 WP_011860828.1.56556 WP_011860828.1.5657 WP_011860828.1.5664 WP_011860828.1.56664 WP_011860828.1.56711 WP_011860828.1.56754 WP_011860828.1.56927 WP_011860828.1.57337 WP_011860828.1.5750 WP_011860828.1.57711 WP_011860828.1.57827 WP_011860828.1.58015 WP_011860828.1.58216 WP_011860828.1.58315 WP_011860828.1.58323 WP_011860828.1.58463 WP_011860828.1.58531 WP_011860828.1.58665 WP_011860828.1.58677 WP_011860828.1.58711 WP_011860828.1.58818 WP_011860828.1.58956 WP_011860828.1.5905 WP_011860828.1.59588 WP_011860828.1.59618 WP_011860828.1.59628 WP_011860828.1.59707 WP_011860828.1.59752 WP_011860828.1.59990 WP_011860828.1.6031 WP_011860828.1.60482 WP_011860828.1.60563 WP_011860828.1.6070 WP_011860828.1.60957 WP_011860828.1.60998 WP_011860828.1.61042 WP_011860828.1.61140 WP_011860828.1.61293 WP_011860828.1.61492 WP_011860828.1.61679 WP_011860828.1.61716 WP_011860828.1.61866 WP_011860828.1.61972 WP_011860828.1.62049 WP_011860828.1.62095 WP_011860828.1.62128 WP_011860828.1.62340 WP_011860828.1.62577 WP_011860828.1.62624 WP_011860828.1.62637 WP_011860828.1.62986 WP_011860828.1.63020 WP_011860828.1.63059 WP_011860828.1.63239 WP_011860828.1.63248 WP_011860828.1.63343 WP_011860828.1.63378 WP_011860828.1.63516 WP_011860828.1.63570 WP_011860828.1.63581 WP_011860828.1.63598 WP_011860828.1.63599 WP_011860828.1.63696 WP_011860828.1.63804 WP_011860828.1.63853 WP_011860828.1.63950 WP_011860828.1.64020 WP_011860828.1.64092 WP_011860828.1.64197 WP_011860828.1.64369 WP_011860828.1.64447 WP_011860828.1.64546 WP_011860828.1.64573 WP_011860828.1.64859 WP_011860828.1.65064 WP_011860828.1.65067 WP_011860828.1.65313 WP_011860828.1.65369 WP_011860828.1.65889 WP_011860828.1.66084 WP_011860828.1.66119 WP_011860828.1.66237 WP_011860828.1.66439 WP_011860828.1.66474 WP_011860828.1.66565 WP_011860828.1.66587 WP_011860828.1.66608 WP_011860828.1.66643 WP_011860828.1.6671 WP_011860828.1.6675 WP_011860828.1.66805 WP_011860828.1.66847 WP_011860828.1.6685 WP_011860828.1.66887 WP_011860828.1.66888 WP_011860828.1.66900 WP_011860828.1.670 WP_011860828.1.67303 WP_011860828.1.67308 WP_011860828.1.6736 WP_011860828.1.67368 WP_011860828.1.67528 WP_011860828.1.67689 WP_011860828.1.67711 WP_011860828.1.6792 WP_011860828.1.67951 WP_011860828.1.68150 WP_011860828.1.68322 WP_011860828.1.68955 WP_011860828.1.6898 WP_011860828.1.68980 WP_011860828.1.69114 WP_011860828.1.692 WP_011860828.1.69333 WP_011860828.1.69495 WP_011860828.1.69708 WP_011860828.1.6994 WP_011860828.1.700 WP_011860828.1.70152 WP_011860828.1.70179 WP_011860828.1.70231 WP_011860828.1.70320 WP_011860828.1.70695 WP_011860828.1.70710 WP_011860828.1.70820 WP_011860828.1.70886 WP_011860828.1.71079 WP_011860828.1.71119 WP_011860828.1.71384 WP_011860828.1.71477 WP_011860828.1.7156 WP_011860828.1.71745 WP_011860828.1.7199 WP_011860828.1.72113 WP_011860828.1.72245 WP_011860828.1.72468 WP_011860828.1.72483 WP_011860828.1.72560 WP_011860828.1.72682 WP_011860828.1.72891 WP_011860828.1.72909 WP_011860828.1.72914 WP_011860828.1.72994 WP_011860828.1.73026 WP_011860828.1.73116 WP_011860828.1.7322 WP_011860828.1.73836 WP_011860828.1.73852 WP_011860828.1.73931 WP_011860828.1.74116 WP_011860828.1.74126 WP_011860828.1.74672 WP_011860828.1.74678 WP_011860828.1.74680 WP_011860828.1.74779 WP_011860828.1.74835 WP_011860828.1.74897 WP_011860828.1.75026 WP_011860828.1.751 WP_011860828.1.75210 WP_011860828.1.75226 WP_011860828.1.75287 WP_011860828.1.75638 WP_011860828.1.75659 WP_011860828.1.76207 WP_011860828.1.7650 WP_011860828.1.76550 WP_011860828.1.76552 WP_011860828.1.76603 WP_011860828.1.76621 WP_011860828.1.76664 WP_011860828.1.76687 WP_011860828.1.76793 WP_011860828.1.76813 WP_011860828.1.76882 WP_011860828.1.76924 WP_011860828.1.7696 WP_011860828.1.77092 WP_011860828.1.77102 WP_011860828.1.77473 WP_011860828.1.77509 WP_011860828.1.77544 WP_011860828.1.7755 WP_011860828.1.77639 WP_011860828.1.77782 WP_011860828.1.77842 WP_011860828.1.77942 WP_011860828.1.78123 WP_011860828.1.78579 WP_011860828.1.78949 WP_011860828.1.7916 WP_011860828.1.79199 WP_011860828.1.79221 WP_011860828.1.79309 WP_011860828.1.79344 WP_011860828.1.79437 WP_011860828.1.79611 WP_011860828.1.79680 WP_011860828.1.79703 WP_011860828.1.79836 WP_011860828.1.79956 WP_011860828.1.80052 WP_011860828.1.80144 WP_011860828.1.80342 WP_011860828.1.80379 WP_011860828.1.80455 WP_011860828.1.80504 WP_011860828.1.80575 WP_011860828.1.80963 WP_011860828.1.81035 WP_011860828.1.81044 WP_011860828.1.81208 WP_011860828.1.81299 WP_011860828.1.81351 WP_011860828.1.81402 WP_011860828.1.81605 WP_011860828.1.81777 WP_011860828.1.82084 WP_011860828.1.82169 WP_011860828.1.82335 WP_011860828.1.82635 WP_011860828.1.82701 WP_011860828.1.82920 WP_011860828.1.8314 WP_011860828.1.83148 WP_011860828.1.83175 WP_011860828.1.83255 WP_011860828.1.83287 WP_011860828.1.83288 WP_011860828.1.83318 WP_011860828.1.83348 WP_011860828.1.8336 WP_011860828.1.834 WP_011860828.1.83477 WP_011860828.1.83515 WP_011860828.1.83822 WP_011860828.1.83918 WP_011860828.1.84253 WP_011860828.1.84528 WP_011860828.1.84646 WP_011860828.1.84843 WP_011860828.1.84880 WP_011860828.1.84923 WP_011860828.1.85020 WP_011860828.1.85127 WP_011860828.1.85214 WP_011860828.1.85219 WP_011860828.1.8527 WP_011860828.1.85420 WP_011860828.1.85454 WP_011860828.1.85776 WP_011860828.1.85863 WP_011860828.1.8587 WP_011860828.1.85874 WP_011860828.1.85932 WP_011860828.1.86008 WP_011860828.1.86011 WP_011860828.1.86049 WP_011860828.1.86088 WP_011860828.1.86094 WP_011860828.1.86116 WP_011860828.1.86117 WP_011860828.1.86328 WP_011860828.1.86395 WP_011860828.1.86534 WP_011860828.1.86743 WP_011860828.1.86914 WP_011860828.1.87058 WP_011860828.1.87195 WP_011860828.1.87326 WP_011860828.1.87454 WP_011860828.1.87714 WP_011860828.1.87723 WP_011860828.1.87730 WP_011860828.1.87918 WP_011860828.1.87932 WP_011860828.1.88091 WP_011860828.1.882 WP_011860828.1.88268 WP_011860828.1.88332 WP_011860828.1.88364 WP_011860828.1.88372 WP_011860828.1.88377 WP_011860828.1.88608 WP_011860828.1.88640 WP_011860828.1.88996 WP_011860828.1.89065 WP_011860828.1.89196 WP_011860828.1.89337 WP_011860828.1.89364 WP_011860828.1.89629 WP_011860828.1.89697 WP_011860828.1.8984 WP_011860828.1.89994 WP_011860828.1.90076 WP_011860828.1.90101 WP_011860828.1.90164 WP_011860828.1.90329 WP_011860828.1.9041 WP_011860828.1.90491 WP_011860828.1.90555 WP_011860828.1.90643 WP_011860828.1.9083 WP_011860828.1.90921 WP_011860828.1.90938 WP_011860828.1.90981 WP_011860828.1.90985 WP_011860828.1.91065 WP_011860828.1.91254 WP_011860828.1.91314 WP_011860828.1.91406 WP_011860828.1.91570 WP_011860828.1.91648 WP_011860828.1.92075 WP_011860828.1.92284 WP_011860828.1.92371 WP_011860828.1.92576 WP_011860828.1.92658 WP_011860828.1.92697 WP_011860828.1.92941 WP_011860828.1.93044 WP_011860828.1.93171 WP_011860828.1.93313 WP_011860828.1.93360 WP_011860828.1.93480 WP_011860828.1.93615 WP_011860828.1.93687 WP_011860828.1.93717 WP_011860828.1.93766 WP_011860828.1.93782 WP_011860828.1.93798 WP_011860828.1.93802 WP_011860828.1.93830 WP_011860828.1.9393 WP_011860828.1.93968 WP_011860828.1.94067 WP_011860828.1.94073 WP_011860828.1.94166 WP_011860828.1.94427 WP_011860828.1.94768 WP_011860828.1.94968 WP_011860828.1.95095 WP_011860828.1.95173 WP_011860828.1.9522 WP_011860828.1.95350 WP_011860828.1.95517 WP_011860828.1.95847 WP_011860828.1.95893 WP_011860828.1.96113 WP_011860828.1.9635 WP_011860828.1.96503 WP_011860828.1.96505 WP_011860828.1.9666 WP_011860828.1.96690 WP_011860828.1.96765 WP_011860828.1.97219 WP_011860828.1.97458 WP_011860828.1.97672 WP_011860828.1.97682 WP_011860828.1.98037 WP_011860828.1.98514 WP_011860828.1.98622 WP_011860828.1.98698 WP_011860828.1.98715 WP_011860828.1.98748 WP_011860828.1.98856 WP_011860828.1.98997 WP_011860828.1.99064 WP_011860828.1.99134 WP_011860828.1.99333 WP_011860828.1.99542 WP_011860828.1.99545 WP_011860828.1.99731 WP_011860828.1.9986 YP_001086946.1.32744 gi|260682190|ref|YP_003213475.1| gi|126698049|ref|YP_001086946.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]