SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260682247|ref|YP_003213532.1| from Clostridium difficile CD196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260682247|ref|YP_003213532.1|
Domain Number 1 Region: 4-118
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.18e-28
Family Penicillinase repressor 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|260682247|ref|YP_003213532.1|
Sequence length 119
Comment penicillin-binding protein repressor [Clostridium difficile CD196]
Sequence
MEIKLFDSELKVMEVLWERGESKAGELVKILKEETGWNRNTTYTVIKKLVSKGAIERIEP
NFVCKALISKEEVQKQETETLINKMFGGSSEKFLSAFINKENLSSDEITKLKQIVEKLK
Download sequence
Identical sequences A0A031WD77 A0A0H3N8N2 A0A0J0UFM9 A0A125V2M1 A0A1F2DJN1 A0A2I2JP24 C9YIS8 Q188Z2 T4IFM6 U3UL37 U3V5V5 U3VFL9
388063 gi|384359814|ref|YP_006197666.1| gi|260685846|ref|YP_003216979.1| gi|126698126|ref|YP_001087023.1| WP_009888340.1.100055 WP_009888340.1.100097 WP_009888340.1.100107 WP_009888340.1.100118 WP_009888340.1.100139 WP_009888340.1.100513 WP_009888340.1.100570 WP_009888340.1.100660 WP_009888340.1.100831 WP_009888340.1.100923 WP_009888340.1.100977 WP_009888340.1.101035 WP_009888340.1.101125 WP_009888340.1.10130 WP_009888340.1.101316 WP_009888340.1.101532 WP_009888340.1.101861 WP_009888340.1.102031 WP_009888340.1.102074 WP_009888340.1.102095 WP_009888340.1.10483 WP_009888340.1.10488 WP_009888340.1.10582 WP_009888340.1.10691 WP_009888340.1.10793 WP_009888340.1.10795 WP_009888340.1.11025 WP_009888340.1.11224 WP_009888340.1.11278 WP_009888340.1.11320 WP_009888340.1.11372 WP_009888340.1.11398 WP_009888340.1.1167 WP_009888340.1.1179 WP_009888340.1.11937 WP_009888340.1.11954 WP_009888340.1.11959 WP_009888340.1.12066 WP_009888340.1.12169 WP_009888340.1.12385 WP_009888340.1.1254 WP_009888340.1.12629 WP_009888340.1.12632 WP_009888340.1.12659 WP_009888340.1.1273 WP_009888340.1.12734 WP_009888340.1.12807 WP_009888340.1.12809 WP_009888340.1.12953 WP_009888340.1.13040 WP_009888340.1.13251 WP_009888340.1.13273 WP_009888340.1.13398 WP_009888340.1.13418 WP_009888340.1.13730 WP_009888340.1.13823 WP_009888340.1.13841 WP_009888340.1.13859 WP_009888340.1.14045 WP_009888340.1.141 WP_009888340.1.14170 WP_009888340.1.14177 WP_009888340.1.14205 WP_009888340.1.1422 WP_009888340.1.14259 WP_009888340.1.14330 WP_009888340.1.14352 WP_009888340.1.1445 WP_009888340.1.14483 WP_009888340.1.14579 WP_009888340.1.14674 WP_009888340.1.14686 WP_009888340.1.14698 WP_009888340.1.14848 WP_009888340.1.1494 WP_009888340.1.15083 WP_009888340.1.15097 WP_009888340.1.15192 WP_009888340.1.15205 WP_009888340.1.15310 WP_009888340.1.15908 WP_009888340.1.16012 WP_009888340.1.16135 WP_009888340.1.16185 WP_009888340.1.16190 WP_009888340.1.16376 WP_009888340.1.16520 WP_009888340.1.16728 WP_009888340.1.169 WP_009888340.1.16931 WP_009888340.1.16966 WP_009888340.1.1705 WP_009888340.1.17371 WP_009888340.1.17413 WP_009888340.1.17463 WP_009888340.1.17512 WP_009888340.1.17611 WP_009888340.1.17638 WP_009888340.1.17808 WP_009888340.1.17851 WP_009888340.1.17879 WP_009888340.1.17908 WP_009888340.1.17960 WP_009888340.1.17998 WP_009888340.1.18060 WP_009888340.1.18207 WP_009888340.1.18212 WP_009888340.1.18298 WP_009888340.1.1838 WP_009888340.1.18407 WP_009888340.1.18455 WP_009888340.1.18462 WP_009888340.1.18551 WP_009888340.1.18680 WP_009888340.1.18970 WP_009888340.1.19088 WP_009888340.1.19152 WP_009888340.1.1926 WP_009888340.1.19290 WP_009888340.1.1934 WP_009888340.1.19627 WP_009888340.1.19648 WP_009888340.1.19704 WP_009888340.1.19899 WP_009888340.1.19956 WP_009888340.1.1999 WP_009888340.1.2002 WP_009888340.1.20132 WP_009888340.1.20184 WP_009888340.1.20302 WP_009888340.1.20313 WP_009888340.1.20481 WP_009888340.1.20650 WP_009888340.1.20728 WP_009888340.1.20872 WP_009888340.1.20875 WP_009888340.1.20960 WP_009888340.1.21000 WP_009888340.1.21048 WP_009888340.1.21201 WP_009888340.1.21220 WP_009888340.1.21520 WP_009888340.1.21547 WP_009888340.1.21618 WP_009888340.1.21704 WP_009888340.1.21893 WP_009888340.1.21925 WP_009888340.1.21980 WP_009888340.1.22020 WP_009888340.1.22079 WP_009888340.1.22128 WP_009888340.1.22222 WP_009888340.1.22228 WP_009888340.1.22313 WP_009888340.1.22395 WP_009888340.1.22417 WP_009888340.1.22568 WP_009888340.1.22569 WP_009888340.1.22615 WP_009888340.1.22768 WP_009888340.1.22893 WP_009888340.1.22937 WP_009888340.1.23096 WP_009888340.1.23208 WP_009888340.1.23287 WP_009888340.1.2363 WP_009888340.1.24197 WP_009888340.1.24457 WP_009888340.1.24520 WP_009888340.1.24889 WP_009888340.1.24900 WP_009888340.1.24987 WP_009888340.1.25128 WP_009888340.1.25416 WP_009888340.1.25761 WP_009888340.1.26024 WP_009888340.1.26358 WP_009888340.1.26482 WP_009888340.1.26494 WP_009888340.1.26697 WP_009888340.1.26829 WP_009888340.1.26940 WP_009888340.1.27300 WP_009888340.1.27563 WP_009888340.1.2758 WP_009888340.1.27677 WP_009888340.1.27708 WP_009888340.1.27824 WP_009888340.1.27872 WP_009888340.1.27881 WP_009888340.1.27890 WP_009888340.1.27967 WP_009888340.1.27989 WP_009888340.1.27996 WP_009888340.1.28055 WP_009888340.1.28410 WP_009888340.1.28715 WP_009888340.1.28856 WP_009888340.1.28882 WP_009888340.1.28890 WP_009888340.1.28930 WP_009888340.1.2923 WP_009888340.1.293 WP_009888340.1.29600 WP_009888340.1.29757 WP_009888340.1.2982 WP_009888340.1.29891 WP_009888340.1.29939 WP_009888340.1.3024 WP_009888340.1.303 WP_009888340.1.3031 WP_009888340.1.30420 WP_009888340.1.30431 WP_009888340.1.30463 WP_009888340.1.30519 WP_009888340.1.30521 WP_009888340.1.30743 WP_009888340.1.30841 WP_009888340.1.30953 WP_009888340.1.31160 WP_009888340.1.31183 WP_009888340.1.31292 WP_009888340.1.31309 WP_009888340.1.31351 WP_009888340.1.31385 WP_009888340.1.31453 WP_009888340.1.31475 WP_009888340.1.31477 WP_009888340.1.31519 WP_009888340.1.31719 WP_009888340.1.31742 WP_009888340.1.31960 WP_009888340.1.32008 WP_009888340.1.32066 WP_009888340.1.32119 WP_009888340.1.32166 WP_009888340.1.32197 WP_009888340.1.32218 WP_009888340.1.32230 WP_009888340.1.32294 WP_009888340.1.32699 WP_009888340.1.32769 WP_009888340.1.32776 WP_009888340.1.32842 WP_009888340.1.32953 WP_009888340.1.33056 WP_009888340.1.33098 WP_009888340.1.33164 WP_009888340.1.33275 WP_009888340.1.33298 WP_009888340.1.33332 WP_009888340.1.33349 WP_009888340.1.3340 WP_009888340.1.33514 WP_009888340.1.33810 WP_009888340.1.34388 WP_009888340.1.34489 WP_009888340.1.34545 WP_009888340.1.34641 WP_009888340.1.34800 WP_009888340.1.34985 WP_009888340.1.35 WP_009888340.1.35002 WP_009888340.1.35137 WP_009888340.1.35181 WP_009888340.1.35187 WP_009888340.1.35234 WP_009888340.1.3559 WP_009888340.1.35709 WP_009888340.1.35832 WP_009888340.1.35884 WP_009888340.1.36078 WP_009888340.1.36257 WP_009888340.1.36338 WP_009888340.1.36738 WP_009888340.1.36835 WP_009888340.1.37255 WP_009888340.1.374 WP_009888340.1.37532 WP_009888340.1.37597 WP_009888340.1.37861 WP_009888340.1.3789 WP_009888340.1.37957 WP_009888340.1.37981 WP_009888340.1.38338 WP_009888340.1.38692 WP_009888340.1.38775 WP_009888340.1.38874 WP_009888340.1.38924 WP_009888340.1.38986 WP_009888340.1.39008 WP_009888340.1.3913 WP_009888340.1.39213 WP_009888340.1.39350 WP_009888340.1.39382 WP_009888340.1.39442 WP_009888340.1.39525 WP_009888340.1.39783 WP_009888340.1.39874 WP_009888340.1.39876 WP_009888340.1.39975 WP_009888340.1.39981 WP_009888340.1.40030 WP_009888340.1.40294 WP_009888340.1.40313 WP_009888340.1.40447 WP_009888340.1.40516 WP_009888340.1.40522 WP_009888340.1.40557 WP_009888340.1.407 WP_009888340.1.40775 WP_009888340.1.40891 WP_009888340.1.40959 WP_009888340.1.40966 WP_009888340.1.41131 WP_009888340.1.4121 WP_009888340.1.41334 WP_009888340.1.41342 WP_009888340.1.4137 WP_009888340.1.41506 WP_009888340.1.41534 WP_009888340.1.41641 WP_009888340.1.41687 WP_009888340.1.41818 WP_009888340.1.41995 WP_009888340.1.42035 WP_009888340.1.4204 WP_009888340.1.42066 WP_009888340.1.42532 WP_009888340.1.42533 WP_009888340.1.42610 WP_009888340.1.42664 WP_009888340.1.43112 WP_009888340.1.4315 WP_009888340.1.4321 WP_009888340.1.43388 WP_009888340.1.43490 WP_009888340.1.43519 WP_009888340.1.43579 WP_009888340.1.43663 WP_009888340.1.43824 WP_009888340.1.4383 WP_009888340.1.44030 WP_009888340.1.44105 WP_009888340.1.44149 WP_009888340.1.44198 WP_009888340.1.44241 WP_009888340.1.44470 WP_009888340.1.44471 WP_009888340.1.44729 WP_009888340.1.45017 WP_009888340.1.45059 WP_009888340.1.45209 WP_009888340.1.45257 WP_009888340.1.45352 WP_009888340.1.45554 WP_009888340.1.4573 WP_009888340.1.45938 WP_009888340.1.45986 WP_009888340.1.46066 WP_009888340.1.46117 WP_009888340.1.46274 WP_009888340.1.46280 WP_009888340.1.46305 WP_009888340.1.46522 WP_009888340.1.4698 WP_009888340.1.47016 WP_009888340.1.47121 WP_009888340.1.47173 WP_009888340.1.47227 WP_009888340.1.47228 WP_009888340.1.47615 WP_009888340.1.47708 WP_009888340.1.47729 WP_009888340.1.47940 WP_009888340.1.48220 WP_009888340.1.48246 WP_009888340.1.48279 WP_009888340.1.4835 WP_009888340.1.48491 WP_009888340.1.48733 WP_009888340.1.48746 WP_009888340.1.48772 WP_009888340.1.48935 WP_009888340.1.48980 WP_009888340.1.48983 WP_009888340.1.48991 WP_009888340.1.49020 WP_009888340.1.49054 WP_009888340.1.4908 WP_009888340.1.49092 WP_009888340.1.49230 WP_009888340.1.49310 WP_009888340.1.49339 WP_009888340.1.49451 WP_009888340.1.4948 WP_009888340.1.49633 WP_009888340.1.50159 WP_009888340.1.50341 WP_009888340.1.50460 WP_009888340.1.50495 WP_009888340.1.5073 WP_009888340.1.50865 WP_009888340.1.51007 WP_009888340.1.51166 WP_009888340.1.51235 WP_009888340.1.5187 WP_009888340.1.51996 WP_009888340.1.52073 WP_009888340.1.52164 WP_009888340.1.52266 WP_009888340.1.52278 WP_009888340.1.52311 WP_009888340.1.52330 WP_009888340.1.52383 WP_009888340.1.52402 WP_009888340.1.52466 WP_009888340.1.52525 WP_009888340.1.52789 WP_009888340.1.52958 WP_009888340.1.52997 WP_009888340.1.53008 WP_009888340.1.53044 WP_009888340.1.53055 WP_009888340.1.53288 WP_009888340.1.5337 WP_009888340.1.53504 WP_009888340.1.53704 WP_009888340.1.53710 WP_009888340.1.53729 WP_009888340.1.54058 WP_009888340.1.54153 WP_009888340.1.5423 WP_009888340.1.54262 WP_009888340.1.54350 WP_009888340.1.54586 WP_009888340.1.54692 WP_009888340.1.55055 WP_009888340.1.55101 WP_009888340.1.5521 WP_009888340.1.55302 WP_009888340.1.55371 WP_009888340.1.55391 WP_009888340.1.5558 WP_009888340.1.559 WP_009888340.1.56006 WP_009888340.1.56217 WP_009888340.1.56252 WP_009888340.1.56323 WP_009888340.1.56337 WP_009888340.1.56556 WP_009888340.1.5657 WP_009888340.1.5661 WP_009888340.1.5664 WP_009888340.1.56664 WP_009888340.1.56711 WP_009888340.1.56754 WP_009888340.1.56927 WP_009888340.1.56998 WP_009888340.1.57337 WP_009888340.1.5750 WP_009888340.1.57711 WP_009888340.1.57827 WP_009888340.1.58015 WP_009888340.1.58216 WP_009888340.1.58304 WP_009888340.1.58315 WP_009888340.1.58323 WP_009888340.1.58463 WP_009888340.1.58665 WP_009888340.1.58677 WP_009888340.1.58711 WP_009888340.1.58818 WP_009888340.1.58956 WP_009888340.1.59032 WP_009888340.1.5905 WP_009888340.1.59588 WP_009888340.1.59618 WP_009888340.1.59628 WP_009888340.1.59707 WP_009888340.1.59752 WP_009888340.1.59990 WP_009888340.1.6031 WP_009888340.1.60482 WP_009888340.1.6070 WP_009888340.1.60957 WP_009888340.1.60998 WP_009888340.1.61140 WP_009888340.1.61293 WP_009888340.1.61492 WP_009888340.1.61679 WP_009888340.1.61716 WP_009888340.1.61866 WP_009888340.1.61972 WP_009888340.1.62049 WP_009888340.1.62095 WP_009888340.1.62128 WP_009888340.1.62340 WP_009888340.1.62577 WP_009888340.1.62624 WP_009888340.1.62637 WP_009888340.1.62797 WP_009888340.1.62941 WP_009888340.1.62986 WP_009888340.1.63020 WP_009888340.1.63059 WP_009888340.1.63239 WP_009888340.1.63248 WP_009888340.1.63343 WP_009888340.1.63378 WP_009888340.1.63516 WP_009888340.1.63581 WP_009888340.1.63598 WP_009888340.1.63599 WP_009888340.1.63696 WP_009888340.1.63804 WP_009888340.1.63852 WP_009888340.1.63853 WP_009888340.1.63950 WP_009888340.1.64020 WP_009888340.1.64092 WP_009888340.1.64197 WP_009888340.1.64369 WP_009888340.1.64447 WP_009888340.1.64546 WP_009888340.1.64573 WP_009888340.1.64859 WP_009888340.1.65064 WP_009888340.1.65067 WP_009888340.1.65313 WP_009888340.1.65369 WP_009888340.1.65889 WP_009888340.1.66084 WP_009888340.1.66119 WP_009888340.1.66237 WP_009888340.1.66439 WP_009888340.1.66474 WP_009888340.1.66565 WP_009888340.1.66587 WP_009888340.1.66608 WP_009888340.1.66643 WP_009888340.1.66701 WP_009888340.1.6671 WP_009888340.1.6675 WP_009888340.1.66805 WP_009888340.1.66847 WP_009888340.1.6685 WP_009888340.1.66887 WP_009888340.1.66888 WP_009888340.1.66900 WP_009888340.1.670 WP_009888340.1.67303 WP_009888340.1.67308 WP_009888340.1.6736 WP_009888340.1.67368 WP_009888340.1.67528 WP_009888340.1.67689 WP_009888340.1.67695 WP_009888340.1.67711 WP_009888340.1.6792 WP_009888340.1.67951 WP_009888340.1.68150 WP_009888340.1.68322 WP_009888340.1.68955 WP_009888340.1.6898 WP_009888340.1.68980 WP_009888340.1.69114 WP_009888340.1.692 WP_009888340.1.69220 WP_009888340.1.69333 WP_009888340.1.69495 WP_009888340.1.69708 WP_009888340.1.6994 WP_009888340.1.700 WP_009888340.1.70152 WP_009888340.1.70179 WP_009888340.1.70231 WP_009888340.1.70320 WP_009888340.1.70464 WP_009888340.1.70695 WP_009888340.1.70710 WP_009888340.1.70820 WP_009888340.1.70886 WP_009888340.1.71079 WP_009888340.1.71119 WP_009888340.1.713 WP_009888340.1.71384 WP_009888340.1.71477 WP_009888340.1.7156 WP_009888340.1.71745 WP_009888340.1.7199 WP_009888340.1.72113 WP_009888340.1.72245 WP_009888340.1.72468 WP_009888340.1.72483 WP_009888340.1.72560 WP_009888340.1.72681 WP_009888340.1.72682 WP_009888340.1.72891 WP_009888340.1.72909 WP_009888340.1.72914 WP_009888340.1.72994 WP_009888340.1.73026 WP_009888340.1.73116 WP_009888340.1.7322 WP_009888340.1.73836 WP_009888340.1.73852 WP_009888340.1.73931 WP_009888340.1.74116 WP_009888340.1.74672 WP_009888340.1.74678 WP_009888340.1.74680 WP_009888340.1.74779 WP_009888340.1.74835 WP_009888340.1.74897 WP_009888340.1.75026 WP_009888340.1.751 WP_009888340.1.75210 WP_009888340.1.75226 WP_009888340.1.75287 WP_009888340.1.75454 WP_009888340.1.75638 WP_009888340.1.75659 WP_009888340.1.76207 WP_009888340.1.7650 WP_009888340.1.76550 WP_009888340.1.76552 WP_009888340.1.76603 WP_009888340.1.76621 WP_009888340.1.76664 WP_009888340.1.76687 WP_009888340.1.76793 WP_009888340.1.76813 WP_009888340.1.76882 WP_009888340.1.76924 WP_009888340.1.7696 WP_009888340.1.77092 WP_009888340.1.77102 WP_009888340.1.77473 WP_009888340.1.77509 WP_009888340.1.77544 WP_009888340.1.7755 WP_009888340.1.77639 WP_009888340.1.77782 WP_009888340.1.77842 WP_009888340.1.77942 WP_009888340.1.78123 WP_009888340.1.78579 WP_009888340.1.78949 WP_009888340.1.79125 WP_009888340.1.7916 WP_009888340.1.79199 WP_009888340.1.79221 WP_009888340.1.79309 WP_009888340.1.79344 WP_009888340.1.79437 WP_009888340.1.79611 WP_009888340.1.79673 WP_009888340.1.79680 WP_009888340.1.79703 WP_009888340.1.79836 WP_009888340.1.79956 WP_009888340.1.80052 WP_009888340.1.80144 WP_009888340.1.80342 WP_009888340.1.80379 WP_009888340.1.80455 WP_009888340.1.80504 WP_009888340.1.80575 WP_009888340.1.80610 WP_009888340.1.80963 WP_009888340.1.81035 WP_009888340.1.81044 WP_009888340.1.81208 WP_009888340.1.81299 WP_009888340.1.81351 WP_009888340.1.81402 WP_009888340.1.81605 WP_009888340.1.81777 WP_009888340.1.82084 WP_009888340.1.82169 WP_009888340.1.82335 WP_009888340.1.82635 WP_009888340.1.82701 WP_009888340.1.82920 WP_009888340.1.8314 WP_009888340.1.83148 WP_009888340.1.83175 WP_009888340.1.83255 WP_009888340.1.83287 WP_009888340.1.83288 WP_009888340.1.83318 WP_009888340.1.83348 WP_009888340.1.8336 WP_009888340.1.834 WP_009888340.1.83477 WP_009888340.1.83515 WP_009888340.1.83641 WP_009888340.1.83822 WP_009888340.1.83918 WP_009888340.1.84195 WP_009888340.1.84253 WP_009888340.1.84606 WP_009888340.1.84646 WP_009888340.1.84843 WP_009888340.1.84880 WP_009888340.1.84923 WP_009888340.1.85020 WP_009888340.1.85127 WP_009888340.1.85214 WP_009888340.1.85219 WP_009888340.1.8527 WP_009888340.1.85420 WP_009888340.1.85442 WP_009888340.1.85454 WP_009888340.1.85776 WP_009888340.1.85863 WP_009888340.1.8587 WP_009888340.1.85874 WP_009888340.1.85932 WP_009888340.1.86008 WP_009888340.1.86011 WP_009888340.1.86049 WP_009888340.1.86088 WP_009888340.1.86094 WP_009888340.1.86116 WP_009888340.1.86117 WP_009888340.1.86328 WP_009888340.1.86395 WP_009888340.1.86534 WP_009888340.1.86767 WP_009888340.1.86914 WP_009888340.1.87058 WP_009888340.1.87195 WP_009888340.1.87326 WP_009888340.1.87454 WP_009888340.1.87714 WP_009888340.1.87723 WP_009888340.1.87730 WP_009888340.1.87918 WP_009888340.1.87932 WP_009888340.1.88091 WP_009888340.1.882 WP_009888340.1.88268 WP_009888340.1.88332 WP_009888340.1.88364 WP_009888340.1.88372 WP_009888340.1.88377 WP_009888340.1.88608 WP_009888340.1.88640 WP_009888340.1.89052 WP_009888340.1.89065 WP_009888340.1.89196 WP_009888340.1.89337 WP_009888340.1.89364 WP_009888340.1.89457 WP_009888340.1.89629 WP_009888340.1.89697 WP_009888340.1.8984 WP_009888340.1.89994 WP_009888340.1.90076 WP_009888340.1.90101 WP_009888340.1.90164 WP_009888340.1.90329 WP_009888340.1.9041 WP_009888340.1.90491 WP_009888340.1.90555 WP_009888340.1.90643 WP_009888340.1.9083 WP_009888340.1.90921 WP_009888340.1.90938 WP_009888340.1.90981 WP_009888340.1.90985 WP_009888340.1.91065 WP_009888340.1.91254 WP_009888340.1.91314 WP_009888340.1.91406 WP_009888340.1.91570 WP_009888340.1.91648 WP_009888340.1.92075 WP_009888340.1.92371 WP_009888340.1.92576 WP_009888340.1.92658 WP_009888340.1.92697 WP_009888340.1.92941 WP_009888340.1.93044 WP_009888340.1.93171 WP_009888340.1.93313 WP_009888340.1.93360 WP_009888340.1.93480 WP_009888340.1.93615 WP_009888340.1.93687 WP_009888340.1.93717 WP_009888340.1.93766 WP_009888340.1.93782 WP_009888340.1.93798 WP_009888340.1.93802 WP_009888340.1.93830 WP_009888340.1.9393 WP_009888340.1.93968 WP_009888340.1.94067 WP_009888340.1.94073 WP_009888340.1.94166 WP_009888340.1.94427 WP_009888340.1.94768 WP_009888340.1.94968 WP_009888340.1.95095 WP_009888340.1.95173 WP_009888340.1.9522 WP_009888340.1.95350 WP_009888340.1.95517 WP_009888340.1.9580 WP_009888340.1.95847 WP_009888340.1.95893 WP_009888340.1.96113 WP_009888340.1.9635 WP_009888340.1.96503 WP_009888340.1.96505 WP_009888340.1.9666 WP_009888340.1.96690 WP_009888340.1.96765 WP_009888340.1.97219 WP_009888340.1.97432 WP_009888340.1.97458 WP_009888340.1.97672 WP_009888340.1.97682 WP_009888340.1.97806 WP_009888340.1.98037 WP_009888340.1.98514 WP_009888340.1.98622 WP_009888340.1.98698 WP_009888340.1.98715 WP_009888340.1.98748 WP_009888340.1.98856 WP_009888340.1.98997 WP_009888340.1.99064 WP_009888340.1.99134 WP_009888340.1.99333 WP_009888340.1.99542 WP_009888340.1.99545 WP_009888340.1.99731 WP_009888340.1.9986 YP_001087023.1.32744 272563.CD0547 645462.CD196_0487 645463.CDR20291_0472 gi|260682247|ref|YP_003213532.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]