SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260682346|ref|YP_003213631.1| from Clostridium difficile CD196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260682346|ref|YP_003213631.1|
Domain Number 1 Region: 5-84
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.67e-21
Family GntR-like transcriptional regulators 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|260682346|ref|YP_003213631.1|
Sequence length 124
Comment GntR family transcriptional regulator [Clostridium difficile CD196]
Sequence
MKVLISNTSDKPLYQQIKEQIKEAIFTEELKEGDAMPSIRNFANDLKVSILTIRRVYEEL
ENEGFLTRQVGIGTFVSTGNLEILRDSKRRIVEQKMADMIKDAKALGITQIELQEMMGIL
YEED
Download sequence
Identical sequences A0A0H3MZJ2 A0A1F2D9E7 C9YJ27
gi|260682346|ref|YP_003213631.1| WP_009888433.1.100097 WP_009888433.1.100139 WP_009888433.1.10130 WP_009888433.1.10488 WP_009888433.1.11025 WP_009888433.1.12169 WP_009888433.1.1273 WP_009888433.1.12809 WP_009888433.1.13040 WP_009888433.1.13251 WP_009888433.1.13398 WP_009888433.1.14170 WP_009888433.1.14205 WP_009888433.1.1445 WP_009888433.1.14483 WP_009888433.1.14674 WP_009888433.1.16520 WP_009888433.1.16728 WP_009888433.1.16931 WP_009888433.1.17638 WP_009888433.1.17851 WP_009888433.1.17879 WP_009888433.1.17908 WP_009888433.1.18298 WP_009888433.1.18455 WP_009888433.1.18680 WP_009888433.1.19152 WP_009888433.1.19899 WP_009888433.1.20650 WP_009888433.1.20875 WP_009888433.1.21220 WP_009888433.1.21618 WP_009888433.1.22020 WP_009888433.1.22222 WP_009888433.1.22937 WP_009888433.1.2363 WP_009888433.1.26829 WP_009888433.1.27677 WP_009888433.1.27989 WP_009888433.1.2923 WP_009888433.1.2982 WP_009888433.1.303 WP_009888433.1.30519 WP_009888433.1.31160 WP_009888433.1.31183 WP_009888433.1.31351 WP_009888433.1.31385 WP_009888433.1.31475 WP_009888433.1.31742 WP_009888433.1.31960 WP_009888433.1.32119 WP_009888433.1.32230 WP_009888433.1.32699 WP_009888433.1.35181 WP_009888433.1.36338 WP_009888433.1.39525 WP_009888433.1.39876 WP_009888433.1.39975 WP_009888433.1.39981 WP_009888433.1.40522 WP_009888433.1.41342 WP_009888433.1.41534 WP_009888433.1.42664 WP_009888433.1.44471 WP_009888433.1.45165 WP_009888433.1.45257 WP_009888433.1.46066 WP_009888433.1.46522 WP_009888433.1.48279 WP_009888433.1.48935 WP_009888433.1.53044 WP_009888433.1.53704 WP_009888433.1.53710 WP_009888433.1.53729 WP_009888433.1.5423 WP_009888433.1.54262 WP_009888433.1.54692 WP_009888433.1.56217 WP_009888433.1.57711 WP_009888433.1.57827 WP_009888433.1.58323 WP_009888433.1.59588 WP_009888433.1.59707 WP_009888433.1.61492 WP_009888433.1.61679 WP_009888433.1.61972 WP_009888433.1.62637 WP_009888433.1.63248 WP_009888433.1.63581 WP_009888433.1.63599 WP_009888433.1.63853 WP_009888433.1.64197 WP_009888433.1.64447 WP_009888433.1.66119 WP_009888433.1.6675 WP_009888433.1.66888 WP_009888433.1.66900 WP_009888433.1.670 WP_009888433.1.6736 WP_009888433.1.67528 WP_009888433.1.67695 WP_009888433.1.68955 WP_009888433.1.6898 WP_009888433.1.69495 WP_009888433.1.700 WP_009888433.1.70152 WP_009888433.1.71745 WP_009888433.1.72682 WP_009888433.1.72909 WP_009888433.1.7322 WP_009888433.1.73931 WP_009888433.1.74116 WP_009888433.1.74680 WP_009888433.1.751 WP_009888433.1.7650 WP_009888433.1.76687 WP_009888433.1.76813 WP_009888433.1.7755 WP_009888433.1.77782 WP_009888433.1.79199 WP_009888433.1.79611 WP_009888433.1.81208 WP_009888433.1.82335 WP_009888433.1.83515 WP_009888433.1.84843 WP_009888433.1.84880 WP_009888433.1.8527 WP_009888433.1.86328 WP_009888433.1.86395 WP_009888433.1.86534 WP_009888433.1.87058 WP_009888433.1.87454 WP_009888433.1.87730 WP_009888433.1.87932 WP_009888433.1.88372 WP_009888433.1.88377 WP_009888433.1.89337 WP_009888433.1.90076 WP_009888433.1.9041 WP_009888433.1.91065 WP_009888433.1.91406 WP_009888433.1.92658 WP_009888433.1.92941 WP_009888433.1.93360 WP_009888433.1.9522 WP_009888433.1.9580 WP_009888433.1.96765 WP_009888433.1.98622 WP_009888433.1.98748 WP_009888433.1.99731 645462.CD196_0592 645463.CDR20291_0574 gi|384359925|ref|YP_006197777.1| gi|260685945|ref|YP_003217078.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]