SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260682352|ref|YP_003213637.1| from Clostridium difficile CD196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260682352|ref|YP_003213637.1|
Domain Number 1 Region: 4-122
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.29e-18
Family Penicillinase repressor 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|260682352|ref|YP_003213637.1|
Sequence length 126
Comment regulatory protein [Clostridium difficile CD196]
Sequence
MYLKKLSKLELVIMKFIWNLDIKTNSYEIIDYMKEEHNLPEKVALKILSKLSKKRFLYVQ
ETGKCMYYTVAIKEKTYLEFISRNVQNLLKNNFIRNLLVSFHEEELTEEKIKSLENWVVN
WEEAYI
Download sequence
Identical sequences A0A0H3N8X3 A0A1F2D9G0 C9YJ33
gi|260682352|ref|YP_003213637.1| gi|384359931|ref|YP_006197783.1| 645462.CD196_0598 645463.CDR20291_0580 WP_009888440.1.100097 WP_009888440.1.100139 WP_009888440.1.10130 WP_009888440.1.10488 WP_009888440.1.11025 WP_009888440.1.12169 WP_009888440.1.1273 WP_009888440.1.12809 WP_009888440.1.13040 WP_009888440.1.13251 WP_009888440.1.13398 WP_009888440.1.14170 WP_009888440.1.14205 WP_009888440.1.1445 WP_009888440.1.14483 WP_009888440.1.16520 WP_009888440.1.16728 WP_009888440.1.16931 WP_009888440.1.17638 WP_009888440.1.17851 WP_009888440.1.17879 WP_009888440.1.17908 WP_009888440.1.18212 WP_009888440.1.18298 WP_009888440.1.18455 WP_009888440.1.18680 WP_009888440.1.19152 WP_009888440.1.19899 WP_009888440.1.20650 WP_009888440.1.20875 WP_009888440.1.21220 WP_009888440.1.21618 WP_009888440.1.22020 WP_009888440.1.22222 WP_009888440.1.22937 WP_009888440.1.2363 WP_009888440.1.26829 WP_009888440.1.27677 WP_009888440.1.27989 WP_009888440.1.2923 WP_009888440.1.2982 WP_009888440.1.303 WP_009888440.1.30519 WP_009888440.1.31160 WP_009888440.1.31183 WP_009888440.1.31351 WP_009888440.1.31385 WP_009888440.1.31475 WP_009888440.1.31742 WP_009888440.1.31960 WP_009888440.1.32119 WP_009888440.1.32230 WP_009888440.1.32699 WP_009888440.1.35181 WP_009888440.1.36338 WP_009888440.1.39525 WP_009888440.1.39876 WP_009888440.1.39975 WP_009888440.1.39981 WP_009888440.1.40522 WP_009888440.1.41342 WP_009888440.1.41534 WP_009888440.1.42664 WP_009888440.1.44471 WP_009888440.1.45165 WP_009888440.1.45257 WP_009888440.1.46066 WP_009888440.1.46522 WP_009888440.1.48279 WP_009888440.1.48935 WP_009888440.1.53044 WP_009888440.1.53704 WP_009888440.1.53710 WP_009888440.1.53729 WP_009888440.1.5423 WP_009888440.1.54262 WP_009888440.1.54692 WP_009888440.1.56217 WP_009888440.1.57711 WP_009888440.1.57827 WP_009888440.1.58323 WP_009888440.1.59588 WP_009888440.1.59707 WP_009888440.1.61492 WP_009888440.1.61679 WP_009888440.1.61972 WP_009888440.1.62637 WP_009888440.1.63248 WP_009888440.1.63581 WP_009888440.1.63599 WP_009888440.1.63853 WP_009888440.1.64197 WP_009888440.1.64447 WP_009888440.1.66119 WP_009888440.1.6675 WP_009888440.1.66888 WP_009888440.1.66900 WP_009888440.1.670 WP_009888440.1.6736 WP_009888440.1.67528 WP_009888440.1.67695 WP_009888440.1.68955 WP_009888440.1.6898 WP_009888440.1.69495 WP_009888440.1.700 WP_009888440.1.70152 WP_009888440.1.71745 WP_009888440.1.72682 WP_009888440.1.72909 WP_009888440.1.7322 WP_009888440.1.73931 WP_009888440.1.74116 WP_009888440.1.74680 WP_009888440.1.751 WP_009888440.1.7650 WP_009888440.1.76687 WP_009888440.1.76813 WP_009888440.1.7755 WP_009888440.1.77782 WP_009888440.1.79199 WP_009888440.1.79611 WP_009888440.1.81208 WP_009888440.1.82335 WP_009888440.1.83515 WP_009888440.1.84843 WP_009888440.1.84880 WP_009888440.1.8527 WP_009888440.1.86328 WP_009888440.1.86395 WP_009888440.1.86534 WP_009888440.1.87058 WP_009888440.1.87454 WP_009888440.1.87730 WP_009888440.1.87932 WP_009888440.1.88372 WP_009888440.1.88377 WP_009888440.1.89337 WP_009888440.1.90076 WP_009888440.1.9041 WP_009888440.1.91065 WP_009888440.1.91406 WP_009888440.1.92658 WP_009888440.1.92941 WP_009888440.1.93360 WP_009888440.1.9522 WP_009888440.1.9580 WP_009888440.1.96765 WP_009888440.1.98622 WP_009888440.1.98748 WP_009888440.1.99731 gi|260685951|ref|YP_003217084.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]