SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260682365|ref|YP_003213650.1| from Clostridium difficile CD196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260682365|ref|YP_003213650.1|
Domain Number 1 Region: 4-124
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.75e-25
Family Penicillinase repressor 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|260682365|ref|YP_003213650.1|
Sequence length 129
Comment regulatory protein [Clostridium difficile CD196]
Sequence
MTIKKLPQSELKIMKFIWKSDSKVTSRDIVLGMEQKYQWKQTTTLTLLSRLVVKRFLNSQ
KIDKYTHYEVLIKEKEYIGVETRDFFRNIHDSSIKSLLLSLHENINLSKDDILLIEEWIK
NLKEEEKDV
Download sequence
Identical sequences A0A031WHJ2 A0A0H3N4B4 A0A0J0Y636 A0A125V341 A0A1F2D547 C9YJ46 G6B4U0 G6BG41 Q189L8 T4IDN3
272563.CD0670 645462.CD196_0611 645463.CDR20291_0593 gi|384359945|ref|YP_006197797.1| WP_003426867.1.100055 WP_003426867.1.100097 WP_003426867.1.100099 WP_003426867.1.100107 WP_003426867.1.100118 WP_003426867.1.100139 WP_003426867.1.100513 WP_003426867.1.100570 WP_003426867.1.100660 WP_003426867.1.100831 WP_003426867.1.100923 WP_003426867.1.100977 WP_003426867.1.101035 WP_003426867.1.101125 WP_003426867.1.101279 WP_003426867.1.10130 WP_003426867.1.101316 WP_003426867.1.101532 WP_003426867.1.101861 WP_003426867.1.101929 WP_003426867.1.102031 WP_003426867.1.102074 WP_003426867.1.102095 WP_003426867.1.10483 WP_003426867.1.10488 WP_003426867.1.10582 WP_003426867.1.10691 WP_003426867.1.10793 WP_003426867.1.10795 WP_003426867.1.11025 WP_003426867.1.11224 WP_003426867.1.11278 WP_003426867.1.11320 WP_003426867.1.11398 WP_003426867.1.1167 WP_003426867.1.1179 WP_003426867.1.11937 WP_003426867.1.12066 WP_003426867.1.12169 WP_003426867.1.12385 WP_003426867.1.1254 WP_003426867.1.12629 WP_003426867.1.12632 WP_003426867.1.12659 WP_003426867.1.1273 WP_003426867.1.12734 WP_003426867.1.12807 WP_003426867.1.12809 WP_003426867.1.12953 WP_003426867.1.13040 WP_003426867.1.13251 WP_003426867.1.13273 WP_003426867.1.13398 WP_003426867.1.13418 WP_003426867.1.13730 WP_003426867.1.13841 WP_003426867.1.13859 WP_003426867.1.14045 WP_003426867.1.141 WP_003426867.1.14170 WP_003426867.1.14177 WP_003426867.1.14205 WP_003426867.1.1422 WP_003426867.1.14259 WP_003426867.1.14330 WP_003426867.1.14352 WP_003426867.1.1445 WP_003426867.1.14457 WP_003426867.1.14483 WP_003426867.1.14579 WP_003426867.1.14674 WP_003426867.1.14686 WP_003426867.1.14698 WP_003426867.1.14848 WP_003426867.1.1494 WP_003426867.1.15083 WP_003426867.1.15097 WP_003426867.1.15192 WP_003426867.1.15205 WP_003426867.1.15435 WP_003426867.1.15908 WP_003426867.1.16012 WP_003426867.1.16135 WP_003426867.1.16185 WP_003426867.1.16190 WP_003426867.1.16376 WP_003426867.1.16520 WP_003426867.1.16728 WP_003426867.1.16897 WP_003426867.1.169 WP_003426867.1.16931 WP_003426867.1.16966 WP_003426867.1.1705 WP_003426867.1.17371 WP_003426867.1.17413 WP_003426867.1.17463 WP_003426867.1.17512 WP_003426867.1.17611 WP_003426867.1.17808 WP_003426867.1.17851 WP_003426867.1.17879 WP_003426867.1.17908 WP_003426867.1.17960 WP_003426867.1.18060 WP_003426867.1.18207 WP_003426867.1.18212 WP_003426867.1.18298 WP_003426867.1.1838 WP_003426867.1.18407 WP_003426867.1.18455 WP_003426867.1.18462 WP_003426867.1.18551 WP_003426867.1.18680 WP_003426867.1.18805 WP_003426867.1.18970 WP_003426867.1.19088 WP_003426867.1.19152 WP_003426867.1.1926 WP_003426867.1.19290 WP_003426867.1.1934 WP_003426867.1.19627 WP_003426867.1.19648 WP_003426867.1.19704 WP_003426867.1.19899 WP_003426867.1.19956 WP_003426867.1.1999 WP_003426867.1.2002 WP_003426867.1.20132 WP_003426867.1.20184 WP_003426867.1.20302 WP_003426867.1.20313 WP_003426867.1.20481 WP_003426867.1.20650 WP_003426867.1.20728 WP_003426867.1.20872 WP_003426867.1.20875 WP_003426867.1.20960 WP_003426867.1.21000 WP_003426867.1.21048 WP_003426867.1.21201 WP_003426867.1.21220 WP_003426867.1.21417 WP_003426867.1.21502 WP_003426867.1.21520 WP_003426867.1.21547 WP_003426867.1.21618 WP_003426867.1.21704 WP_003426867.1.21893 WP_003426867.1.22020 WP_003426867.1.22079 WP_003426867.1.22128 WP_003426867.1.22222 WP_003426867.1.22228 WP_003426867.1.22313 WP_003426867.1.22357 WP_003426867.1.22411 WP_003426867.1.22417 WP_003426867.1.22568 WP_003426867.1.22569 WP_003426867.1.22615 WP_003426867.1.22768 WP_003426867.1.22893 WP_003426867.1.22937 WP_003426867.1.23096 WP_003426867.1.23208 WP_003426867.1.23287 WP_003426867.1.23338 WP_003426867.1.2363 WP_003426867.1.24197 WP_003426867.1.24457 WP_003426867.1.24520 WP_003426867.1.24826 WP_003426867.1.24889 WP_003426867.1.24900 WP_003426867.1.24987 WP_003426867.1.25128 WP_003426867.1.25416 WP_003426867.1.25761 WP_003426867.1.26024 WP_003426867.1.26044 WP_003426867.1.26358 WP_003426867.1.26482 WP_003426867.1.26494 WP_003426867.1.26697 WP_003426867.1.26829 WP_003426867.1.26940 WP_003426867.1.27563 WP_003426867.1.27677 WP_003426867.1.27708 WP_003426867.1.27824 WP_003426867.1.27872 WP_003426867.1.27881 WP_003426867.1.27890 WP_003426867.1.27967 WP_003426867.1.27989 WP_003426867.1.27996 WP_003426867.1.28055 WP_003426867.1.28410 WP_003426867.1.28638 WP_003426867.1.28715 WP_003426867.1.28856 WP_003426867.1.28882 WP_003426867.1.28890 WP_003426867.1.28930 WP_003426867.1.2923 WP_003426867.1.293 WP_003426867.1.29600 WP_003426867.1.29757 WP_003426867.1.2982 WP_003426867.1.29891 WP_003426867.1.3024 WP_003426867.1.303 WP_003426867.1.3031 WP_003426867.1.30420 WP_003426867.1.30431 WP_003426867.1.30463 WP_003426867.1.30519 WP_003426867.1.30521 WP_003426867.1.30743 WP_003426867.1.30841 WP_003426867.1.30953 WP_003426867.1.31160 WP_003426867.1.31183 WP_003426867.1.31203 WP_003426867.1.31292 WP_003426867.1.31309 WP_003426867.1.31351 WP_003426867.1.31385 WP_003426867.1.31453 WP_003426867.1.31475 WP_003426867.1.31477 WP_003426867.1.31519 WP_003426867.1.31637 WP_003426867.1.31719 WP_003426867.1.31742 WP_003426867.1.31960 WP_003426867.1.31969 WP_003426867.1.32008 WP_003426867.1.32066 WP_003426867.1.32119 WP_003426867.1.32166 WP_003426867.1.32197 WP_003426867.1.32218 WP_003426867.1.32230 WP_003426867.1.32294 WP_003426867.1.32699 WP_003426867.1.32769 WP_003426867.1.32776 WP_003426867.1.32842 WP_003426867.1.33056 WP_003426867.1.33098 WP_003426867.1.33164 WP_003426867.1.33298 WP_003426867.1.33332 WP_003426867.1.33349 WP_003426867.1.3340 WP_003426867.1.33514 WP_003426867.1.33810 WP_003426867.1.34388 WP_003426867.1.34489 WP_003426867.1.34545 WP_003426867.1.34641 WP_003426867.1.34800 WP_003426867.1.34985 WP_003426867.1.34989 WP_003426867.1.35 WP_003426867.1.35002 WP_003426867.1.35137 WP_003426867.1.35181 WP_003426867.1.35187 WP_003426867.1.35234 WP_003426867.1.3559 WP_003426867.1.35709 WP_003426867.1.35832 WP_003426867.1.35884 WP_003426867.1.36078 WP_003426867.1.36257 WP_003426867.1.36338 WP_003426867.1.36738 WP_003426867.1.36835 WP_003426867.1.37255 WP_003426867.1.374 WP_003426867.1.37493 WP_003426867.1.37532 WP_003426867.1.37597 WP_003426867.1.37861 WP_003426867.1.3789 WP_003426867.1.37957 WP_003426867.1.37981 WP_003426867.1.38305 WP_003426867.1.38338 WP_003426867.1.38692 WP_003426867.1.38775 WP_003426867.1.38814 WP_003426867.1.38874 WP_003426867.1.38924 WP_003426867.1.38986 WP_003426867.1.39008 WP_003426867.1.3913 WP_003426867.1.39213 WP_003426867.1.39350 WP_003426867.1.39382 WP_003426867.1.39442 WP_003426867.1.39525 WP_003426867.1.39621 WP_003426867.1.39783 WP_003426867.1.39874 WP_003426867.1.39876 WP_003426867.1.39975 WP_003426867.1.39981 WP_003426867.1.40030 WP_003426867.1.40313 WP_003426867.1.40447 WP_003426867.1.40522 WP_003426867.1.40557 WP_003426867.1.407 WP_003426867.1.40775 WP_003426867.1.40891 WP_003426867.1.40959 WP_003426867.1.40966 WP_003426867.1.41131 WP_003426867.1.4121 WP_003426867.1.41334 WP_003426867.1.41342 WP_003426867.1.4137 WP_003426867.1.41506 WP_003426867.1.41534 WP_003426867.1.41641 WP_003426867.1.41687 WP_003426867.1.41818 WP_003426867.1.41995 WP_003426867.1.42035 WP_003426867.1.4204 WP_003426867.1.42066 WP_003426867.1.42532 WP_003426867.1.42533 WP_003426867.1.42610 WP_003426867.1.42664 WP_003426867.1.43112 WP_003426867.1.4315 WP_003426867.1.4321 WP_003426867.1.43388 WP_003426867.1.43490 WP_003426867.1.43519 WP_003426867.1.43579 WP_003426867.1.43663 WP_003426867.1.43824 WP_003426867.1.4383 WP_003426867.1.44030 WP_003426867.1.44105 WP_003426867.1.44149 WP_003426867.1.44198 WP_003426867.1.44241 WP_003426867.1.44470 WP_003426867.1.44471 WP_003426867.1.44729 WP_003426867.1.45017 WP_003426867.1.45059 WP_003426867.1.45142 WP_003426867.1.45165 WP_003426867.1.45209 WP_003426867.1.45257 WP_003426867.1.45352 WP_003426867.1.45554 WP_003426867.1.4573 WP_003426867.1.45938 WP_003426867.1.45986 WP_003426867.1.46066 WP_003426867.1.46274 WP_003426867.1.46280 WP_003426867.1.46305 WP_003426867.1.46522 WP_003426867.1.4698 WP_003426867.1.47016 WP_003426867.1.47121 WP_003426867.1.47173 WP_003426867.1.47227 WP_003426867.1.47228 WP_003426867.1.47479 WP_003426867.1.47615 WP_003426867.1.47708 WP_003426867.1.47729 WP_003426867.1.47940 WP_003426867.1.48220 WP_003426867.1.48246 WP_003426867.1.48279 WP_003426867.1.4835 WP_003426867.1.48733 WP_003426867.1.48746 WP_003426867.1.48772 WP_003426867.1.48935 WP_003426867.1.48980 WP_003426867.1.48983 WP_003426867.1.48991 WP_003426867.1.49020 WP_003426867.1.49054 WP_003426867.1.49065 WP_003426867.1.4908 WP_003426867.1.49092 WP_003426867.1.49230 WP_003426867.1.49310 WP_003426867.1.4948 WP_003426867.1.49633 WP_003426867.1.50159 WP_003426867.1.50341 WP_003426867.1.50460 WP_003426867.1.5073 WP_003426867.1.50865 WP_003426867.1.51007 WP_003426867.1.51235 WP_003426867.1.51675 WP_003426867.1.5187 WP_003426867.1.51996 WP_003426867.1.52073 WP_003426867.1.52266 WP_003426867.1.52278 WP_003426867.1.52294 WP_003426867.1.52311 WP_003426867.1.52330 WP_003426867.1.52383 WP_003426867.1.52402 WP_003426867.1.52466 WP_003426867.1.52525 WP_003426867.1.52789 WP_003426867.1.52958 WP_003426867.1.52997 WP_003426867.1.53008 WP_003426867.1.53044 WP_003426867.1.53055 WP_003426867.1.5337 WP_003426867.1.53504 WP_003426867.1.53704 WP_003426867.1.53710 WP_003426867.1.53729 WP_003426867.1.53987 WP_003426867.1.54058 WP_003426867.1.54153 WP_003426867.1.5423 WP_003426867.1.54262 WP_003426867.1.54350 WP_003426867.1.54586 WP_003426867.1.54593 WP_003426867.1.54692 WP_003426867.1.55055 WP_003426867.1.55101 WP_003426867.1.5521 WP_003426867.1.55302 WP_003426867.1.55371 WP_003426867.1.55391 WP_003426867.1.5558 WP_003426867.1.559 WP_003426867.1.56006 WP_003426867.1.56252 WP_003426867.1.56323 WP_003426867.1.56337 WP_003426867.1.56556 WP_003426867.1.5657 WP_003426867.1.5661 WP_003426867.1.5664 WP_003426867.1.56664 WP_003426867.1.56711 WP_003426867.1.56754 WP_003426867.1.56927 WP_003426867.1.56998 WP_003426867.1.57099 WP_003426867.1.57337 WP_003426867.1.5750 WP_003426867.1.57711 WP_003426867.1.57827 WP_003426867.1.58015 WP_003426867.1.58216 WP_003426867.1.58304 WP_003426867.1.58315 WP_003426867.1.58323 WP_003426867.1.58463 WP_003426867.1.58531 WP_003426867.1.58665 WP_003426867.1.58677 WP_003426867.1.58711 WP_003426867.1.58818 WP_003426867.1.58956 WP_003426867.1.5905 WP_003426867.1.59588 WP_003426867.1.59618 WP_003426867.1.59628 WP_003426867.1.59707 WP_003426867.1.59752 WP_003426867.1.59990 WP_003426867.1.60040 WP_003426867.1.6031 WP_003426867.1.60482 WP_003426867.1.60563 WP_003426867.1.6070 WP_003426867.1.60957 WP_003426867.1.60998 WP_003426867.1.61042 WP_003426867.1.61140 WP_003426867.1.61293 WP_003426867.1.61492 WP_003426867.1.61679 WP_003426867.1.61716 WP_003426867.1.61866 WP_003426867.1.61972 WP_003426867.1.62049 WP_003426867.1.62095 WP_003426867.1.62128 WP_003426867.1.62340 WP_003426867.1.62577 WP_003426867.1.62624 WP_003426867.1.62637 WP_003426867.1.62941 WP_003426867.1.62986 WP_003426867.1.63020 WP_003426867.1.63059 WP_003426867.1.63237 WP_003426867.1.63239 WP_003426867.1.63248 WP_003426867.1.63343 WP_003426867.1.63378 WP_003426867.1.63516 WP_003426867.1.63570 WP_003426867.1.63581 WP_003426867.1.63598 WP_003426867.1.63599 WP_003426867.1.63696 WP_003426867.1.63804 WP_003426867.1.63853 WP_003426867.1.63950 WP_003426867.1.64020 WP_003426867.1.64092 WP_003426867.1.64197 WP_003426867.1.64369 WP_003426867.1.64447 WP_003426867.1.64546 WP_003426867.1.64573 WP_003426867.1.64859 WP_003426867.1.65064 WP_003426867.1.65067 WP_003426867.1.65313 WP_003426867.1.65369 WP_003426867.1.65889 WP_003426867.1.66084 WP_003426867.1.66119 WP_003426867.1.66237 WP_003426867.1.66439 WP_003426867.1.66474 WP_003426867.1.66565 WP_003426867.1.66587 WP_003426867.1.66643 WP_003426867.1.66701 WP_003426867.1.6671 WP_003426867.1.6675 WP_003426867.1.66805 WP_003426867.1.66847 WP_003426867.1.6685 WP_003426867.1.66887 WP_003426867.1.66888 WP_003426867.1.66900 WP_003426867.1.670 WP_003426867.1.67303 WP_003426867.1.67308 WP_003426867.1.6736 WP_003426867.1.67368 WP_003426867.1.67528 WP_003426867.1.67689 WP_003426867.1.67695 WP_003426867.1.67711 WP_003426867.1.6792 WP_003426867.1.67951 WP_003426867.1.68150 WP_003426867.1.68276 WP_003426867.1.68322 WP_003426867.1.68955 WP_003426867.1.6898 WP_003426867.1.68980 WP_003426867.1.69114 WP_003426867.1.692 WP_003426867.1.69220 WP_003426867.1.69333 WP_003426867.1.69495 WP_003426867.1.69708 WP_003426867.1.6994 WP_003426867.1.700 WP_003426867.1.70152 WP_003426867.1.70179 WP_003426867.1.70231 WP_003426867.1.70320 WP_003426867.1.70695 WP_003426867.1.70710 WP_003426867.1.70820 WP_003426867.1.70886 WP_003426867.1.71079 WP_003426867.1.71119 WP_003426867.1.713 WP_003426867.1.71384 WP_003426867.1.71477 WP_003426867.1.7156 WP_003426867.1.71745 WP_003426867.1.7199 WP_003426867.1.72113 WP_003426867.1.72245 WP_003426867.1.72468 WP_003426867.1.72483 WP_003426867.1.72560 WP_003426867.1.72681 WP_003426867.1.72682 WP_003426867.1.72891 WP_003426867.1.72909 WP_003426867.1.72914 WP_003426867.1.72994 WP_003426867.1.73026 WP_003426867.1.73116 WP_003426867.1.7322 WP_003426867.1.73605 WP_003426867.1.73836 WP_003426867.1.73852 WP_003426867.1.73931 WP_003426867.1.74050 WP_003426867.1.74116 WP_003426867.1.74126 WP_003426867.1.74672 WP_003426867.1.74678 WP_003426867.1.74680 WP_003426867.1.74779 WP_003426867.1.74835 WP_003426867.1.74897 WP_003426867.1.75026 WP_003426867.1.751 WP_003426867.1.75210 WP_003426867.1.75226 WP_003426867.1.75287 WP_003426867.1.75454 WP_003426867.1.75638 WP_003426867.1.75659 WP_003426867.1.76207 WP_003426867.1.7650 WP_003426867.1.76550 WP_003426867.1.76552 WP_003426867.1.76603 WP_003426867.1.76621 WP_003426867.1.76664 WP_003426867.1.76687 WP_003426867.1.76793 WP_003426867.1.76813 WP_003426867.1.76882 WP_003426867.1.76924 WP_003426867.1.7696 WP_003426867.1.77092 WP_003426867.1.77102 WP_003426867.1.77473 WP_003426867.1.77509 WP_003426867.1.77544 WP_003426867.1.7755 WP_003426867.1.77639 WP_003426867.1.77782 WP_003426867.1.77842 WP_003426867.1.77942 WP_003426867.1.78123 WP_003426867.1.78579 WP_003426867.1.78949 WP_003426867.1.7916 WP_003426867.1.79199 WP_003426867.1.79221 WP_003426867.1.79309 WP_003426867.1.79344 WP_003426867.1.79437 WP_003426867.1.79611 WP_003426867.1.79680 WP_003426867.1.79703 WP_003426867.1.79836 WP_003426867.1.79956 WP_003426867.1.80052 WP_003426867.1.80144 WP_003426867.1.80342 WP_003426867.1.80379 WP_003426867.1.80455 WP_003426867.1.80504 WP_003426867.1.80575 WP_003426867.1.80963 WP_003426867.1.81035 WP_003426867.1.81044 WP_003426867.1.81208 WP_003426867.1.81299 WP_003426867.1.81351 WP_003426867.1.81402 WP_003426867.1.81605 WP_003426867.1.81777 WP_003426867.1.82002 WP_003426867.1.82084 WP_003426867.1.82150 WP_003426867.1.82169 WP_003426867.1.82335 WP_003426867.1.82635 WP_003426867.1.82701 WP_003426867.1.82920 WP_003426867.1.8314 WP_003426867.1.83148 WP_003426867.1.83175 WP_003426867.1.83255 WP_003426867.1.83287 WP_003426867.1.83288 WP_003426867.1.83318 WP_003426867.1.83348 WP_003426867.1.8336 WP_003426867.1.834 WP_003426867.1.83477 WP_003426867.1.83515 WP_003426867.1.83822 WP_003426867.1.83918 WP_003426867.1.84253 WP_003426867.1.84528 WP_003426867.1.84646 WP_003426867.1.84843 WP_003426867.1.84880 WP_003426867.1.84923 WP_003426867.1.85020 WP_003426867.1.85127 WP_003426867.1.85214 WP_003426867.1.85219 WP_003426867.1.8527 WP_003426867.1.85420 WP_003426867.1.85442 WP_003426867.1.85454 WP_003426867.1.85776 WP_003426867.1.85863 WP_003426867.1.8587 WP_003426867.1.85874 WP_003426867.1.85932 WP_003426867.1.86008 WP_003426867.1.86011 WP_003426867.1.86049 WP_003426867.1.86088 WP_003426867.1.86094 WP_003426867.1.86116 WP_003426867.1.86117 WP_003426867.1.86328 WP_003426867.1.86395 WP_003426867.1.86534 WP_003426867.1.86618 WP_003426867.1.86767 WP_003426867.1.86837 WP_003426867.1.86914 WP_003426867.1.87058 WP_003426867.1.87195 WP_003426867.1.87326 WP_003426867.1.87454 WP_003426867.1.87714 WP_003426867.1.87723 WP_003426867.1.87730 WP_003426867.1.87918 WP_003426867.1.87932 WP_003426867.1.88091 WP_003426867.1.882 WP_003426867.1.88268 WP_003426867.1.88332 WP_003426867.1.88364 WP_003426867.1.88372 WP_003426867.1.88377 WP_003426867.1.88608 WP_003426867.1.88640 WP_003426867.1.88996 WP_003426867.1.89052 WP_003426867.1.89065 WP_003426867.1.89196 WP_003426867.1.89337 WP_003426867.1.89364 WP_003426867.1.89457 WP_003426867.1.89541 WP_003426867.1.89629 WP_003426867.1.89697 WP_003426867.1.8984 WP_003426867.1.89994 WP_003426867.1.90076 WP_003426867.1.90101 WP_003426867.1.90164 WP_003426867.1.90329 WP_003426867.1.9041 WP_003426867.1.90491 WP_003426867.1.90555 WP_003426867.1.90643 WP_003426867.1.9083 WP_003426867.1.90921 WP_003426867.1.90938 WP_003426867.1.90981 WP_003426867.1.90985 WP_003426867.1.91065 WP_003426867.1.91254 WP_003426867.1.91314 WP_003426867.1.91406 WP_003426867.1.91570 WP_003426867.1.91648 WP_003426867.1.92075 WP_003426867.1.92284 WP_003426867.1.92371 WP_003426867.1.92576 WP_003426867.1.92658 WP_003426867.1.92697 WP_003426867.1.92941 WP_003426867.1.93044 WP_003426867.1.93171 WP_003426867.1.93313 WP_003426867.1.93360 WP_003426867.1.93480 WP_003426867.1.93615 WP_003426867.1.93687 WP_003426867.1.93717 WP_003426867.1.93766 WP_003426867.1.93782 WP_003426867.1.93798 WP_003426867.1.93802 WP_003426867.1.93830 WP_003426867.1.9393 WP_003426867.1.93968 WP_003426867.1.94067 WP_003426867.1.94073 WP_003426867.1.94166 WP_003426867.1.94427 WP_003426867.1.94768 WP_003426867.1.94831 WP_003426867.1.94968 WP_003426867.1.95095 WP_003426867.1.95173 WP_003426867.1.9522 WP_003426867.1.95350 WP_003426867.1.95517 WP_003426867.1.95847 WP_003426867.1.95893 WP_003426867.1.96113 WP_003426867.1.9635 WP_003426867.1.96503 WP_003426867.1.96505 WP_003426867.1.9666 WP_003426867.1.96690 WP_003426867.1.96765 WP_003426867.1.97219 WP_003426867.1.97458 WP_003426867.1.97672 WP_003426867.1.97682 WP_003426867.1.97806 WP_003426867.1.98037 WP_003426867.1.98514 WP_003426867.1.98622 WP_003426867.1.98698 WP_003426867.1.98715 WP_003426867.1.98748 WP_003426867.1.98856 WP_003426867.1.98913 WP_003426867.1.98997 WP_003426867.1.99064 WP_003426867.1.99134 WP_003426867.1.99333 WP_003426867.1.99542 WP_003426867.1.99545 WP_003426867.1.99731 WP_003426867.1.9986 YP_001087146.1.32744 gi|260685964|ref|YP_003217097.1| gi|126698249|ref|YP_001087146.1| gi|260682365|ref|YP_003213650.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]