SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260682525|ref|YP_003213810.1| from Clostridium difficile CD196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260682525|ref|YP_003213810.1|
Domain Number 1 Region: 1-121
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.45e-30
Family FUR-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|260682525|ref|YP_003213810.1|
Sequence length 129
Comment oxidative stress regulatory protein [Clostridium difficile CD196]
Sequence
MKFSKQRELILNEILNNPVHPTADYLYENLKKDNPNLSLGTVYRNLAQLTEHGFIRKVSI
PGYPDRFDGRIDNHYHIICEVCGEVYDLESEVLNNLQELISEETDIKITSYNISFKGICN
NCKRCSQVG
Download sequence
Identical sequences A0A0H3N4S8 A0A0J0UGF8 A0A125V3E2 A0A160W8Z2 A0A1F2D704 C9YJK6 T4HXI3
gi|260682525|ref|YP_003213810.1| WP_009888638.1.100097 WP_009888638.1.100107 WP_009888638.1.100118 WP_009888638.1.100139 WP_009888638.1.100513 WP_009888638.1.100570 WP_009888638.1.100660 WP_009888638.1.100831 WP_009888638.1.100977 WP_009888638.1.101035 WP_009888638.1.101125 WP_009888638.1.101279 WP_009888638.1.10130 WP_009888638.1.101316 WP_009888638.1.101532 WP_009888638.1.101861 WP_009888638.1.102031 WP_009888638.1.102095 WP_009888638.1.10488 WP_009888638.1.10582 WP_009888638.1.10691 WP_009888638.1.10795 WP_009888638.1.11025 WP_009888638.1.11224 WP_009888638.1.11278 WP_009888638.1.11398 WP_009888638.1.1167 WP_009888638.1.1179 WP_009888638.1.11959 WP_009888638.1.12066 WP_009888638.1.12169 WP_009888638.1.12385 WP_009888638.1.1254 WP_009888638.1.12629 WP_009888638.1.12632 WP_009888638.1.12659 WP_009888638.1.1273 WP_009888638.1.12734 WP_009888638.1.12807 WP_009888638.1.12809 WP_009888638.1.13040 WP_009888638.1.13251 WP_009888638.1.13398 WP_009888638.1.13418 WP_009888638.1.13841 WP_009888638.1.13859 WP_009888638.1.14045 WP_009888638.1.141 WP_009888638.1.14170 WP_009888638.1.14205 WP_009888638.1.1422 WP_009888638.1.14330 WP_009888638.1.14352 WP_009888638.1.1445 WP_009888638.1.14457 WP_009888638.1.14483 WP_009888638.1.14579 WP_009888638.1.14674 WP_009888638.1.14698 WP_009888638.1.14848 WP_009888638.1.1494 WP_009888638.1.15083 WP_009888638.1.15097 WP_009888638.1.15192 WP_009888638.1.15205 WP_009888638.1.15310 WP_009888638.1.15435 WP_009888638.1.15908 WP_009888638.1.16012 WP_009888638.1.16135 WP_009888638.1.16185 WP_009888638.1.16376 WP_009888638.1.16520 WP_009888638.1.16728 WP_009888638.1.169 WP_009888638.1.16931 WP_009888638.1.16966 WP_009888638.1.1705 WP_009888638.1.17371 WP_009888638.1.17413 WP_009888638.1.17463 WP_009888638.1.17512 WP_009888638.1.17638 WP_009888638.1.17808 WP_009888638.1.17851 WP_009888638.1.17879 WP_009888638.1.17908 WP_009888638.1.17960 WP_009888638.1.18060 WP_009888638.1.18207 WP_009888638.1.18212 WP_009888638.1.18298 WP_009888638.1.18407 WP_009888638.1.18455 WP_009888638.1.18462 WP_009888638.1.18551 WP_009888638.1.18680 WP_009888638.1.18805 WP_009888638.1.18970 WP_009888638.1.19088 WP_009888638.1.19152 WP_009888638.1.1926 WP_009888638.1.1934 WP_009888638.1.19648 WP_009888638.1.19704 WP_009888638.1.19899 WP_009888638.1.19956 WP_009888638.1.1999 WP_009888638.1.2002 WP_009888638.1.20132 WP_009888638.1.20184 WP_009888638.1.20302 WP_009888638.1.20313 WP_009888638.1.20481 WP_009888638.1.20650 WP_009888638.1.20728 WP_009888638.1.20872 WP_009888638.1.20875 WP_009888638.1.21000 WP_009888638.1.21201 WP_009888638.1.21220 WP_009888638.1.21520 WP_009888638.1.21547 WP_009888638.1.21618 WP_009888638.1.21704 WP_009888638.1.21893 WP_009888638.1.22020 WP_009888638.1.22079 WP_009888638.1.22222 WP_009888638.1.22228 WP_009888638.1.22313 WP_009888638.1.22411 WP_009888638.1.22417 WP_009888638.1.22568 WP_009888638.1.22569 WP_009888638.1.22768 WP_009888638.1.22893 WP_009888638.1.22937 WP_009888638.1.23096 WP_009888638.1.23287 WP_009888638.1.23338 WP_009888638.1.2363 WP_009888638.1.24457 WP_009888638.1.24520 WP_009888638.1.24889 WP_009888638.1.24900 WP_009888638.1.24987 WP_009888638.1.25128 WP_009888638.1.25416 WP_009888638.1.25761 WP_009888638.1.26358 WP_009888638.1.26482 WP_009888638.1.26494 WP_009888638.1.26697 WP_009888638.1.26829 WP_009888638.1.2758 WP_009888638.1.27677 WP_009888638.1.27708 WP_009888638.1.27824 WP_009888638.1.27872 WP_009888638.1.27881 WP_009888638.1.27890 WP_009888638.1.27967 WP_009888638.1.27989 WP_009888638.1.27996 WP_009888638.1.28055 WP_009888638.1.28410 WP_009888638.1.28638 WP_009888638.1.28856 WP_009888638.1.28882 WP_009888638.1.28890 WP_009888638.1.28930 WP_009888638.1.2923 WP_009888638.1.293 WP_009888638.1.29600 WP_009888638.1.29757 WP_009888638.1.2982 WP_009888638.1.29891 WP_009888638.1.3024 WP_009888638.1.303 WP_009888638.1.3031 WP_009888638.1.30420 WP_009888638.1.30431 WP_009888638.1.30519 WP_009888638.1.30521 WP_009888638.1.30743 WP_009888638.1.30841 WP_009888638.1.30953 WP_009888638.1.31160 WP_009888638.1.31183 WP_009888638.1.31203 WP_009888638.1.31309 WP_009888638.1.31351 WP_009888638.1.31385 WP_009888638.1.31453 WP_009888638.1.31475 WP_009888638.1.31477 WP_009888638.1.31519 WP_009888638.1.31637 WP_009888638.1.31719 WP_009888638.1.31742 WP_009888638.1.31960 WP_009888638.1.31969 WP_009888638.1.32066 WP_009888638.1.32119 WP_009888638.1.32166 WP_009888638.1.32197 WP_009888638.1.32218 WP_009888638.1.32230 WP_009888638.1.32699 WP_009888638.1.32769 WP_009888638.1.32842 WP_009888638.1.33056 WP_009888638.1.33164 WP_009888638.1.33298 WP_009888638.1.33332 WP_009888638.1.33349 WP_009888638.1.3340 WP_009888638.1.33514 WP_009888638.1.33810 WP_009888638.1.34388 WP_009888638.1.34489 WP_009888638.1.34545 WP_009888638.1.34641 WP_009888638.1.34800 WP_009888638.1.34985 WP_009888638.1.35 WP_009888638.1.35002 WP_009888638.1.35137 WP_009888638.1.35181 WP_009888638.1.35187 WP_009888638.1.3559 WP_009888638.1.35832 WP_009888638.1.36078 WP_009888638.1.36257 WP_009888638.1.36338 WP_009888638.1.36738 WP_009888638.1.36835 WP_009888638.1.37255 WP_009888638.1.374 WP_009888638.1.37493 WP_009888638.1.37532 WP_009888638.1.3789 WP_009888638.1.37981 WP_009888638.1.38305 WP_009888638.1.38692 WP_009888638.1.38775 WP_009888638.1.38814 WP_009888638.1.38874 WP_009888638.1.38924 WP_009888638.1.38986 WP_009888638.1.39008 WP_009888638.1.3913 WP_009888638.1.39213 WP_009888638.1.39382 WP_009888638.1.39442 WP_009888638.1.39525 WP_009888638.1.39621 WP_009888638.1.39783 WP_009888638.1.39876 WP_009888638.1.39975 WP_009888638.1.39981 WP_009888638.1.40030 WP_009888638.1.40313 WP_009888638.1.40447 WP_009888638.1.40522 WP_009888638.1.40557 WP_009888638.1.407 WP_009888638.1.40775 WP_009888638.1.40891 WP_009888638.1.40959 WP_009888638.1.40966 WP_009888638.1.41131 WP_009888638.1.41334 WP_009888638.1.41342 WP_009888638.1.41506 WP_009888638.1.41534 WP_009888638.1.41641 WP_009888638.1.41687 WP_009888638.1.41818 WP_009888638.1.42035 WP_009888638.1.4204 WP_009888638.1.42066 WP_009888638.1.42532 WP_009888638.1.42533 WP_009888638.1.42610 WP_009888638.1.42664 WP_009888638.1.4315 WP_009888638.1.4321 WP_009888638.1.43388 WP_009888638.1.43519 WP_009888638.1.43579 WP_009888638.1.43663 WP_009888638.1.43824 WP_009888638.1.44030 WP_009888638.1.44105 WP_009888638.1.44198 WP_009888638.1.44241 WP_009888638.1.44470 WP_009888638.1.44471 WP_009888638.1.44729 WP_009888638.1.45017 WP_009888638.1.45059 WP_009888638.1.45142 WP_009888638.1.45165 WP_009888638.1.45209 WP_009888638.1.45257 WP_009888638.1.45352 WP_009888638.1.45554 WP_009888638.1.4573 WP_009888638.1.45938 WP_009888638.1.45986 WP_009888638.1.46066 WP_009888638.1.46274 WP_009888638.1.46280 WP_009888638.1.46305 WP_009888638.1.46522 WP_009888638.1.4698 WP_009888638.1.47016 WP_009888638.1.47121 WP_009888638.1.47227 WP_009888638.1.47228 WP_009888638.1.47479 WP_009888638.1.47615 WP_009888638.1.47729 WP_009888638.1.47940 WP_009888638.1.48246 WP_009888638.1.48279 WP_009888638.1.4835 WP_009888638.1.48746 WP_009888638.1.48772 WP_009888638.1.48935 WP_009888638.1.48980 WP_009888638.1.48983 WP_009888638.1.48991 WP_009888638.1.49020 WP_009888638.1.49065 WP_009888638.1.4908 WP_009888638.1.49092 WP_009888638.1.49230 WP_009888638.1.49310 WP_009888638.1.49339 WP_009888638.1.4948 WP_009888638.1.49633 WP_009888638.1.5073 WP_009888638.1.50865 WP_009888638.1.51235 WP_009888638.1.51675 WP_009888638.1.51996 WP_009888638.1.52073 WP_009888638.1.52266 WP_009888638.1.52278 WP_009888638.1.52330 WP_009888638.1.52402 WP_009888638.1.52466 WP_009888638.1.52525 WP_009888638.1.52997 WP_009888638.1.53008 WP_009888638.1.53044 WP_009888638.1.5337 WP_009888638.1.53504 WP_009888638.1.53704 WP_009888638.1.53710 WP_009888638.1.53729 WP_009888638.1.53987 WP_009888638.1.54058 WP_009888638.1.54153 WP_009888638.1.5423 WP_009888638.1.54262 WP_009888638.1.54350 WP_009888638.1.54586 WP_009888638.1.54692 WP_009888638.1.55055 WP_009888638.1.55101 WP_009888638.1.55302 WP_009888638.1.55371 WP_009888638.1.55391 WP_009888638.1.5558 WP_009888638.1.559 WP_009888638.1.56217 WP_009888638.1.56252 WP_009888638.1.56323 WP_009888638.1.56337 WP_009888638.1.56556 WP_009888638.1.5657 WP_009888638.1.5661 WP_009888638.1.56664 WP_009888638.1.56754 WP_009888638.1.56927 WP_009888638.1.56998 WP_009888638.1.57337 WP_009888638.1.5750 WP_009888638.1.57711 WP_009888638.1.57827 WP_009888638.1.58015 WP_009888638.1.58216 WP_009888638.1.58315 WP_009888638.1.58323 WP_009888638.1.58531 WP_009888638.1.58665 WP_009888638.1.58677 WP_009888638.1.58711 WP_009888638.1.58818 WP_009888638.1.58956 WP_009888638.1.59032 WP_009888638.1.59588 WP_009888638.1.59618 WP_009888638.1.59707 WP_009888638.1.6031 WP_009888638.1.60563 WP_009888638.1.6070 WP_009888638.1.60957 WP_009888638.1.60998 WP_009888638.1.61042 WP_009888638.1.61293 WP_009888638.1.61492 WP_009888638.1.61716 WP_009888638.1.61866 WP_009888638.1.62049 WP_009888638.1.62095 WP_009888638.1.62128 WP_009888638.1.62340 WP_009888638.1.62624 WP_009888638.1.62637 WP_009888638.1.62941 WP_009888638.1.62986 WP_009888638.1.63020 WP_009888638.1.63239 WP_009888638.1.63248 WP_009888638.1.63343 WP_009888638.1.63378 WP_009888638.1.63516 WP_009888638.1.63570 WP_009888638.1.63581 WP_009888638.1.63598 WP_009888638.1.63599 WP_009888638.1.63696 WP_009888638.1.63804 WP_009888638.1.63853 WP_009888638.1.64020 WP_009888638.1.64197 WP_009888638.1.64369 WP_009888638.1.64447 WP_009888638.1.64573 WP_009888638.1.64859 WP_009888638.1.65064 WP_009888638.1.65067 WP_009888638.1.65889 WP_009888638.1.66084 WP_009888638.1.66119 WP_009888638.1.66237 WP_009888638.1.66439 WP_009888638.1.66474 WP_009888638.1.66565 WP_009888638.1.66587 WP_009888638.1.66608 WP_009888638.1.66643 WP_009888638.1.66701 WP_009888638.1.6671 WP_009888638.1.6675 WP_009888638.1.66805 WP_009888638.1.66847 WP_009888638.1.6685 WP_009888638.1.66887 WP_009888638.1.66888 WP_009888638.1.66900 WP_009888638.1.670 WP_009888638.1.67303 WP_009888638.1.67308 WP_009888638.1.6736 WP_009888638.1.67528 WP_009888638.1.67689 WP_009888638.1.67695 WP_009888638.1.67711 WP_009888638.1.6792 WP_009888638.1.67951 WP_009888638.1.68150 WP_009888638.1.68322 WP_009888638.1.68955 WP_009888638.1.6898 WP_009888638.1.68980 WP_009888638.1.69114 WP_009888638.1.692 WP_009888638.1.69220 WP_009888638.1.69333 WP_009888638.1.69495 WP_009888638.1.700 WP_009888638.1.70152 WP_009888638.1.70179 WP_009888638.1.70231 WP_009888638.1.70320 WP_009888638.1.70695 WP_009888638.1.70710 WP_009888638.1.70820 WP_009888638.1.70886 WP_009888638.1.71119 WP_009888638.1.713 WP_009888638.1.71477 WP_009888638.1.7156 WP_009888638.1.71745 WP_009888638.1.72113 WP_009888638.1.72245 WP_009888638.1.72468 WP_009888638.1.72560 WP_009888638.1.72682 WP_009888638.1.72909 WP_009888638.1.72914 WP_009888638.1.72994 WP_009888638.1.73026 WP_009888638.1.73116 WP_009888638.1.7322 WP_009888638.1.73852 WP_009888638.1.73931 WP_009888638.1.74116 WP_009888638.1.74126 WP_009888638.1.74680 WP_009888638.1.74835 WP_009888638.1.74897 WP_009888638.1.751 WP_009888638.1.75210 WP_009888638.1.75226 WP_009888638.1.75287 WP_009888638.1.75454 WP_009888638.1.75659 WP_009888638.1.76207 WP_009888638.1.7650 WP_009888638.1.76552 WP_009888638.1.76603 WP_009888638.1.76621 WP_009888638.1.76687 WP_009888638.1.76793 WP_009888638.1.76813 WP_009888638.1.76882 WP_009888638.1.76924 WP_009888638.1.7696 WP_009888638.1.77092 WP_009888638.1.77102 WP_009888638.1.77473 WP_009888638.1.77509 WP_009888638.1.77544 WP_009888638.1.7755 WP_009888638.1.77639 WP_009888638.1.77782 WP_009888638.1.77842 WP_009888638.1.77942 WP_009888638.1.78949 WP_009888638.1.79199 WP_009888638.1.79221 WP_009888638.1.79309 WP_009888638.1.79611 WP_009888638.1.79680 WP_009888638.1.79836 WP_009888638.1.79956 WP_009888638.1.80052 WP_009888638.1.80144 WP_009888638.1.80342 WP_009888638.1.80379 WP_009888638.1.80455 WP_009888638.1.80504 WP_009888638.1.80575 WP_009888638.1.80963 WP_009888638.1.81208 WP_009888638.1.81299 WP_009888638.1.81351 WP_009888638.1.81402 WP_009888638.1.81605 WP_009888638.1.81777 WP_009888638.1.82084 WP_009888638.1.82169 WP_009888638.1.82335 WP_009888638.1.82635 WP_009888638.1.82701 WP_009888638.1.82920 WP_009888638.1.8314 WP_009888638.1.83148 WP_009888638.1.83288 WP_009888638.1.83318 WP_009888638.1.83348 WP_009888638.1.834 WP_009888638.1.83477 WP_009888638.1.83515 WP_009888638.1.83822 WP_009888638.1.83918 WP_009888638.1.84253 WP_009888638.1.84528 WP_009888638.1.84646 WP_009888638.1.84843 WP_009888638.1.84880 WP_009888638.1.85020 WP_009888638.1.85214 WP_009888638.1.85219 WP_009888638.1.8527 WP_009888638.1.85420 WP_009888638.1.85442 WP_009888638.1.85454 WP_009888638.1.85776 WP_009888638.1.85863 WP_009888638.1.8587 WP_009888638.1.85874 WP_009888638.1.85932 WP_009888638.1.86011 WP_009888638.1.86049 WP_009888638.1.86094 WP_009888638.1.86116 WP_009888638.1.86117 WP_009888638.1.86328 WP_009888638.1.86395 WP_009888638.1.86534 WP_009888638.1.86743 WP_009888638.1.86767 WP_009888638.1.86837 WP_009888638.1.86914 WP_009888638.1.87058 WP_009888638.1.87195 WP_009888638.1.87454 WP_009888638.1.87723 WP_009888638.1.87730 WP_009888638.1.87918 WP_009888638.1.87932 WP_009888638.1.88091 WP_009888638.1.88268 WP_009888638.1.88332 WP_009888638.1.88364 WP_009888638.1.88372 WP_009888638.1.88377 WP_009888638.1.88608 WP_009888638.1.88640 WP_009888638.1.88996 WP_009888638.1.89052 WP_009888638.1.89065 WP_009888638.1.89196 WP_009888638.1.89337 WP_009888638.1.89364 WP_009888638.1.89457 WP_009888638.1.89629 WP_009888638.1.89697 WP_009888638.1.89994 WP_009888638.1.90076 WP_009888638.1.90101 WP_009888638.1.90164 WP_009888638.1.90329 WP_009888638.1.9041 WP_009888638.1.90491 WP_009888638.1.90555 WP_009888638.1.90643 WP_009888638.1.9083 WP_009888638.1.90921 WP_009888638.1.90938 WP_009888638.1.90981 WP_009888638.1.91065 WP_009888638.1.91254 WP_009888638.1.91314 WP_009888638.1.91406 WP_009888638.1.91570 WP_009888638.1.92284 WP_009888638.1.92371 WP_009888638.1.92576 WP_009888638.1.92658 WP_009888638.1.92697 WP_009888638.1.92941 WP_009888638.1.93044 WP_009888638.1.93171 WP_009888638.1.93313 WP_009888638.1.93360 WP_009888638.1.93480 WP_009888638.1.93615 WP_009888638.1.93687 WP_009888638.1.93766 WP_009888638.1.93782 WP_009888638.1.93798 WP_009888638.1.93802 WP_009888638.1.93830 WP_009888638.1.9393 WP_009888638.1.94067 WP_009888638.1.94768 WP_009888638.1.95095 WP_009888638.1.95173 WP_009888638.1.9522 WP_009888638.1.95350 WP_009888638.1.95517 WP_009888638.1.9580 WP_009888638.1.95847 WP_009888638.1.95893 WP_009888638.1.9635 WP_009888638.1.96505 WP_009888638.1.9666 WP_009888638.1.96765 WP_009888638.1.97458 WP_009888638.1.97672 WP_009888638.1.97682 WP_009888638.1.97806 WP_009888638.1.98037 WP_009888638.1.98514 WP_009888638.1.98622 WP_009888638.1.98698 WP_009888638.1.98748 WP_009888638.1.98856 WP_009888638.1.99134 WP_009888638.1.99333 WP_009888638.1.99545 WP_009888638.1.99731 WP_009888638.1.9986 gi|260686124|ref|YP_003217257.1| gi|384360103|ref|YP_006197955.1| 645462.CD196_0775 645463.CDR20291_0756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]