SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260682551|ref|YP_003213836.1| from Clostridium difficile CD196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260682551|ref|YP_003213836.1|
Domain Number 1 Region: 12-144
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.77e-26
Family MarR-like transcriptional regulators 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|260682551|ref|YP_003213836.1|
Sequence length 147
Comment MarR family transcriptional regulator [Clostridium difficile CD196]
Sequence
MILLKSNYDCFRIAMLLKELYSKTMYTVEENFKENGLTHQQIIVIKLVAHNQELTISQLC
DEMSLAKGTVSGIISRLEQIGYIEKFKKSNDKRNTYVKFTTTGFEFATNFKIKMQESFDD
IFKNCDENELSDLVKNLRNILAKVKER
Download sequence
Identical sequences A0A0H3N044 C9YJN2
gi|260686150|ref|YP_003217283.1| 645462.CD196_0801 645463.CDR20291_0782 gi|260682551|ref|YP_003213836.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]