SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260682759|ref|YP_003214044.1| from Clostridium difficile CD196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260682759|ref|YP_003214044.1|
Domain Number 1 Region: 5-107
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.11e-23
Family PadR-like 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|260682759|ref|YP_003214044.1|
Sequence length 109
Comment PadR family transcriptional regulator [Clostridium difficile CD196]
Sequence
MQLNKEVLKGYIDILIVSILEKKDCYGYEIAKQVRERSEFELKEGTMYLALKRMESKNLI
KSYYSNEQSSGGRRKYYNLTNEGKDFLEIKKQEWRFIKKVMNQFLGEVD
Download sequence
Identical sequences A0A031WG81 A0A0H3N0T8 A0A125V5M1 A0A1F2D680 A0A2I2JRL4 C9YK90 D5Q5E5 D5S361 Q18B15 U3UKH8 U3V7F6 U3VFW0
gi|126698749|ref|YP_001087646.1| gi|260686357|ref|YP_003217490.1| gi|384360341|ref|YP_006198193.1| WP_003419063.1.100055 WP_003419063.1.100097 WP_003419063.1.100107 WP_003419063.1.100118 WP_003419063.1.100139 WP_003419063.1.100570 WP_003419063.1.100660 WP_003419063.1.100831 WP_003419063.1.100977 WP_003419063.1.101035 WP_003419063.1.101125 WP_003419063.1.101279 WP_003419063.1.10130 WP_003419063.1.101316 WP_003419063.1.101532 WP_003419063.1.102031 WP_003419063.1.102074 WP_003419063.1.102095 WP_003419063.1.10483 WP_003419063.1.10488 WP_003419063.1.10582 WP_003419063.1.10691 WP_003419063.1.10793 WP_003419063.1.11025 WP_003419063.1.11224 WP_003419063.1.11278 WP_003419063.1.11320 WP_003419063.1.11372 WP_003419063.1.1167 WP_003419063.1.1179 WP_003419063.1.11937 WP_003419063.1.11959 WP_003419063.1.12066 WP_003419063.1.12169 WP_003419063.1.12385 WP_003419063.1.1254 WP_003419063.1.12629 WP_003419063.1.12632 WP_003419063.1.12659 WP_003419063.1.1273 WP_003419063.1.12734 WP_003419063.1.12807 WP_003419063.1.12809 WP_003419063.1.13040 WP_003419063.1.13251 WP_003419063.1.13273 WP_003419063.1.13398 WP_003419063.1.13418 WP_003419063.1.13730 WP_003419063.1.13823 WP_003419063.1.13841 WP_003419063.1.13859 WP_003419063.1.14045 WP_003419063.1.141 WP_003419063.1.14170 WP_003419063.1.14177 WP_003419063.1.14205 WP_003419063.1.1422 WP_003419063.1.14259 WP_003419063.1.14330 WP_003419063.1.14352 WP_003419063.1.1445 WP_003419063.1.14457 WP_003419063.1.14483 WP_003419063.1.14579 WP_003419063.1.14674 WP_003419063.1.14686 WP_003419063.1.14698 WP_003419063.1.14848 WP_003419063.1.1494 WP_003419063.1.15083 WP_003419063.1.15097 WP_003419063.1.15192 WP_003419063.1.15205 WP_003419063.1.15310 WP_003419063.1.15435 WP_003419063.1.15908 WP_003419063.1.16012 WP_003419063.1.16135 WP_003419063.1.16185 WP_003419063.1.16376 WP_003419063.1.16520 WP_003419063.1.16728 WP_003419063.1.169 WP_003419063.1.16931 WP_003419063.1.1705 WP_003419063.1.17371 WP_003419063.1.17413 WP_003419063.1.17463 WP_003419063.1.17512 WP_003419063.1.17611 WP_003419063.1.17638 WP_003419063.1.17808 WP_003419063.1.17851 WP_003419063.1.17879 WP_003419063.1.17908 WP_003419063.1.17960 WP_003419063.1.17998 WP_003419063.1.18060 WP_003419063.1.18207 WP_003419063.1.18212 WP_003419063.1.18298 WP_003419063.1.1838 WP_003419063.1.18407 WP_003419063.1.18455 WP_003419063.1.18462 WP_003419063.1.18551 WP_003419063.1.18680 WP_003419063.1.18805 WP_003419063.1.18970 WP_003419063.1.19088 WP_003419063.1.19152 WP_003419063.1.1926 WP_003419063.1.19290 WP_003419063.1.1934 WP_003419063.1.19648 WP_003419063.1.19704 WP_003419063.1.19899 WP_003419063.1.19956 WP_003419063.1.1999 WP_003419063.1.2002 WP_003419063.1.20132 WP_003419063.1.20184 WP_003419063.1.20302 WP_003419063.1.20313 WP_003419063.1.20481 WP_003419063.1.20650 WP_003419063.1.20728 WP_003419063.1.20872 WP_003419063.1.20875 WP_003419063.1.20960 WP_003419063.1.21000 WP_003419063.1.21048 WP_003419063.1.21220 WP_003419063.1.21417 WP_003419063.1.21520 WP_003419063.1.21547 WP_003419063.1.21618 WP_003419063.1.21704 WP_003419063.1.21893 WP_003419063.1.21925 WP_003419063.1.21980 WP_003419063.1.22020 WP_003419063.1.22079 WP_003419063.1.22222 WP_003419063.1.22228 WP_003419063.1.22395 WP_003419063.1.22411 WP_003419063.1.22417 WP_003419063.1.22568 WP_003419063.1.22569 WP_003419063.1.22615 WP_003419063.1.22768 WP_003419063.1.22893 WP_003419063.1.22937 WP_003419063.1.23096 WP_003419063.1.23208 WP_003419063.1.23287 WP_003419063.1.23338 WP_003419063.1.2363 WP_003419063.1.24197 WP_003419063.1.24457 WP_003419063.1.24520 WP_003419063.1.24900 WP_003419063.1.24987 WP_003419063.1.25128 WP_003419063.1.25416 WP_003419063.1.25761 WP_003419063.1.26024 WP_003419063.1.26358 WP_003419063.1.26482 WP_003419063.1.26494 WP_003419063.1.26697 WP_003419063.1.26829 WP_003419063.1.26940 WP_003419063.1.27300 WP_003419063.1.2758 WP_003419063.1.27677 WP_003419063.1.27708 WP_003419063.1.27872 WP_003419063.1.27881 WP_003419063.1.27890 WP_003419063.1.27967 WP_003419063.1.27989 WP_003419063.1.27996 WP_003419063.1.28055 WP_003419063.1.28410 WP_003419063.1.28638 WP_003419063.1.28715 WP_003419063.1.28856 WP_003419063.1.28882 WP_003419063.1.28890 WP_003419063.1.28930 WP_003419063.1.2923 WP_003419063.1.293 WP_003419063.1.29600 WP_003419063.1.29757 WP_003419063.1.2982 WP_003419063.1.29891 WP_003419063.1.29939 WP_003419063.1.3024 WP_003419063.1.303 WP_003419063.1.30420 WP_003419063.1.30431 WP_003419063.1.30463 WP_003419063.1.30519 WP_003419063.1.30521 WP_003419063.1.30743 WP_003419063.1.30841 WP_003419063.1.30953 WP_003419063.1.31160 WP_003419063.1.31183 WP_003419063.1.31203 WP_003419063.1.31292 WP_003419063.1.31309 WP_003419063.1.31351 WP_003419063.1.31385 WP_003419063.1.31475 WP_003419063.1.31477 WP_003419063.1.31637 WP_003419063.1.31719 WP_003419063.1.31742 WP_003419063.1.31960 WP_003419063.1.31969 WP_003419063.1.32008 WP_003419063.1.32066 WP_003419063.1.32119 WP_003419063.1.32166 WP_003419063.1.32197 WP_003419063.1.32218 WP_003419063.1.32230 WP_003419063.1.32294 WP_003419063.1.32699 WP_003419063.1.32769 WP_003419063.1.32776 WP_003419063.1.32842 WP_003419063.1.32953 WP_003419063.1.33056 WP_003419063.1.33098 WP_003419063.1.33275 WP_003419063.1.33298 WP_003419063.1.33332 WP_003419063.1.33349 WP_003419063.1.3340 WP_003419063.1.33514 WP_003419063.1.33810 WP_003419063.1.34388 WP_003419063.1.34489 WP_003419063.1.34545 WP_003419063.1.34641 WP_003419063.1.34800 WP_003419063.1.34985 WP_003419063.1.35 WP_003419063.1.35137 WP_003419063.1.35181 WP_003419063.1.35187 WP_003419063.1.35234 WP_003419063.1.3559 WP_003419063.1.35884 WP_003419063.1.36078 WP_003419063.1.36257 WP_003419063.1.36338 WP_003419063.1.36738 WP_003419063.1.37255 WP_003419063.1.374 WP_003419063.1.37493 WP_003419063.1.37532 WP_003419063.1.37597 WP_003419063.1.37861 WP_003419063.1.3789 WP_003419063.1.37957 WP_003419063.1.38305 WP_003419063.1.38338 WP_003419063.1.38692 WP_003419063.1.38775 WP_003419063.1.38814 WP_003419063.1.38874 WP_003419063.1.38924 WP_003419063.1.38986 WP_003419063.1.39008 WP_003419063.1.3913 WP_003419063.1.39213 WP_003419063.1.39350 WP_003419063.1.39382 WP_003419063.1.39442 WP_003419063.1.39525 WP_003419063.1.39621 WP_003419063.1.39874 WP_003419063.1.39876 WP_003419063.1.39975 WP_003419063.1.39981 WP_003419063.1.40030 WP_003419063.1.40294 WP_003419063.1.40313 WP_003419063.1.40447 WP_003419063.1.40516 WP_003419063.1.40522 WP_003419063.1.40557 WP_003419063.1.407 WP_003419063.1.40891 WP_003419063.1.40959 WP_003419063.1.40966 WP_003419063.1.41131 WP_003419063.1.4121 WP_003419063.1.41334 WP_003419063.1.41342 WP_003419063.1.4137 WP_003419063.1.41506 WP_003419063.1.41534 WP_003419063.1.41641 WP_003419063.1.41687 WP_003419063.1.41818 WP_003419063.1.41995 WP_003419063.1.42035 WP_003419063.1.4204 WP_003419063.1.42532 WP_003419063.1.42533 WP_003419063.1.42610 WP_003419063.1.42664 WP_003419063.1.43112 WP_003419063.1.4315 WP_003419063.1.4321 WP_003419063.1.43388 WP_003419063.1.43490 WP_003419063.1.43579 WP_003419063.1.43663 WP_003419063.1.43824 WP_003419063.1.4383 WP_003419063.1.44030 WP_003419063.1.44105 WP_003419063.1.44149 WP_003419063.1.44241 WP_003419063.1.44471 WP_003419063.1.44729 WP_003419063.1.45017 WP_003419063.1.45059 WP_003419063.1.45142 WP_003419063.1.45165 WP_003419063.1.45209 WP_003419063.1.45257 WP_003419063.1.45352 WP_003419063.1.45554 WP_003419063.1.4573 WP_003419063.1.45938 WP_003419063.1.45986 WP_003419063.1.46066 WP_003419063.1.46117 WP_003419063.1.46280 WP_003419063.1.46522 WP_003419063.1.4698 WP_003419063.1.47121 WP_003419063.1.47227 WP_003419063.1.47228 WP_003419063.1.47479 WP_003419063.1.47615 WP_003419063.1.47708 WP_003419063.1.47729 WP_003419063.1.47940 WP_003419063.1.48246 WP_003419063.1.48279 WP_003419063.1.4835 WP_003419063.1.48491 WP_003419063.1.48746 WP_003419063.1.48772 WP_003419063.1.48935 WP_003419063.1.48980 WP_003419063.1.48991 WP_003419063.1.49020 WP_003419063.1.49054 WP_003419063.1.49065 WP_003419063.1.4908 WP_003419063.1.49230 WP_003419063.1.49310 WP_003419063.1.49339 WP_003419063.1.49451 WP_003419063.1.4948 WP_003419063.1.49633 WP_003419063.1.50159 WP_003419063.1.50341 WP_003419063.1.50495 WP_003419063.1.5073 WP_003419063.1.50865 WP_003419063.1.51007 WP_003419063.1.51166 WP_003419063.1.51235 WP_003419063.1.51675 WP_003419063.1.51996 WP_003419063.1.52073 WP_003419063.1.52164 WP_003419063.1.52311 WP_003419063.1.52330 WP_003419063.1.52383 WP_003419063.1.52402 WP_003419063.1.52525 WP_003419063.1.52789 WP_003419063.1.52958 WP_003419063.1.53008 WP_003419063.1.53044 WP_003419063.1.53055 WP_003419063.1.53288 WP_003419063.1.5337 WP_003419063.1.53504 WP_003419063.1.53704 WP_003419063.1.53710 WP_003419063.1.53729 WP_003419063.1.53987 WP_003419063.1.54058 WP_003419063.1.54153 WP_003419063.1.5423 WP_003419063.1.54262 WP_003419063.1.54350 WP_003419063.1.54586 WP_003419063.1.54692 WP_003419063.1.55101 WP_003419063.1.5521 WP_003419063.1.55302 WP_003419063.1.55371 WP_003419063.1.55391 WP_003419063.1.5558 WP_003419063.1.559 WP_003419063.1.56006 WP_003419063.1.56217 WP_003419063.1.56252 WP_003419063.1.56323 WP_003419063.1.56337 WP_003419063.1.56556 WP_003419063.1.5657 WP_003419063.1.5661 WP_003419063.1.5664 WP_003419063.1.56664 WP_003419063.1.56711 WP_003419063.1.56927 WP_003419063.1.56998 WP_003419063.1.57337 WP_003419063.1.5750 WP_003419063.1.57711 WP_003419063.1.57827 WP_003419063.1.58015 WP_003419063.1.58216 WP_003419063.1.58304 WP_003419063.1.58315 WP_003419063.1.58323 WP_003419063.1.58463 WP_003419063.1.58531 WP_003419063.1.58677 WP_003419063.1.58711 WP_003419063.1.58818 WP_003419063.1.59032 WP_003419063.1.5905 WP_003419063.1.59588 WP_003419063.1.59618 WP_003419063.1.59628 WP_003419063.1.59707 WP_003419063.1.59752 WP_003419063.1.59990 WP_003419063.1.6031 WP_003419063.1.60482 WP_003419063.1.60563 WP_003419063.1.6070 WP_003419063.1.60957 WP_003419063.1.60998 WP_003419063.1.61042 WP_003419063.1.61140 WP_003419063.1.61293 WP_003419063.1.61492 WP_003419063.1.61679 WP_003419063.1.61716 WP_003419063.1.61866 WP_003419063.1.61972 WP_003419063.1.62049 WP_003419063.1.62095 WP_003419063.1.62128 WP_003419063.1.62340 WP_003419063.1.62577 WP_003419063.1.62624 WP_003419063.1.62637 WP_003419063.1.62797 WP_003419063.1.62941 WP_003419063.1.62986 WP_003419063.1.63020 WP_003419063.1.63059 WP_003419063.1.63248 WP_003419063.1.63343 WP_003419063.1.63516 WP_003419063.1.63570 WP_003419063.1.63581 WP_003419063.1.63598 WP_003419063.1.63599 WP_003419063.1.63804 WP_003419063.1.63852 WP_003419063.1.63853 WP_003419063.1.64020 WP_003419063.1.64092 WP_003419063.1.64197 WP_003419063.1.64447 WP_003419063.1.64546 WP_003419063.1.64573 WP_003419063.1.64859 WP_003419063.1.65064 WP_003419063.1.65067 WP_003419063.1.65369 WP_003419063.1.65889 WP_003419063.1.66084 WP_003419063.1.66119 WP_003419063.1.66237 WP_003419063.1.66439 WP_003419063.1.66474 WP_003419063.1.66587 WP_003419063.1.66643 WP_003419063.1.66701 WP_003419063.1.6675 WP_003419063.1.66805 WP_003419063.1.66847 WP_003419063.1.66887 WP_003419063.1.66888 WP_003419063.1.670 WP_003419063.1.67303 WP_003419063.1.67308 WP_003419063.1.6736 WP_003419063.1.67368 WP_003419063.1.67528 WP_003419063.1.67689 WP_003419063.1.67695 WP_003419063.1.67711 WP_003419063.1.6792 WP_003419063.1.67951 WP_003419063.1.68150 WP_003419063.1.68955 WP_003419063.1.6898 WP_003419063.1.68980 WP_003419063.1.69114 WP_003419063.1.692 WP_003419063.1.69220 WP_003419063.1.69333 WP_003419063.1.69495 WP_003419063.1.69708 WP_003419063.1.6994 WP_003419063.1.700 WP_003419063.1.70152 WP_003419063.1.70179 WP_003419063.1.70231 WP_003419063.1.70320 WP_003419063.1.70464 WP_003419063.1.70695 WP_003419063.1.70710 WP_003419063.1.71079 WP_003419063.1.71119 WP_003419063.1.713 WP_003419063.1.71384 WP_003419063.1.71477 WP_003419063.1.71745 WP_003419063.1.7199 WP_003419063.1.72113 WP_003419063.1.72245 WP_003419063.1.72468 WP_003419063.1.72483 WP_003419063.1.72560 WP_003419063.1.72682 WP_003419063.1.72891 WP_003419063.1.72909 WP_003419063.1.72914 WP_003419063.1.72994 WP_003419063.1.73026 WP_003419063.1.73116 WP_003419063.1.7322 WP_003419063.1.73852 WP_003419063.1.73931 WP_003419063.1.74116 WP_003419063.1.74126 WP_003419063.1.74672 WP_003419063.1.74678 WP_003419063.1.74680 WP_003419063.1.74835 WP_003419063.1.74897 WP_003419063.1.75026 WP_003419063.1.751 WP_003419063.1.75210 WP_003419063.1.75226 WP_003419063.1.75454 WP_003419063.1.75638 WP_003419063.1.75659 WP_003419063.1.76207 WP_003419063.1.7650 WP_003419063.1.76550 WP_003419063.1.76552 WP_003419063.1.76603 WP_003419063.1.76621 WP_003419063.1.76664 WP_003419063.1.76687 WP_003419063.1.76793 WP_003419063.1.76813 WP_003419063.1.76882 WP_003419063.1.76924 WP_003419063.1.7696 WP_003419063.1.77092 WP_003419063.1.77102 WP_003419063.1.77473 WP_003419063.1.77509 WP_003419063.1.77544 WP_003419063.1.7755 WP_003419063.1.77639 WP_003419063.1.77782 WP_003419063.1.77842 WP_003419063.1.77942 WP_003419063.1.78123 WP_003419063.1.78579 WP_003419063.1.78949 WP_003419063.1.79125 WP_003419063.1.7916 WP_003419063.1.79199 WP_003419063.1.79221 WP_003419063.1.79309 WP_003419063.1.79344 WP_003419063.1.79437 WP_003419063.1.79611 WP_003419063.1.79673 WP_003419063.1.79703 WP_003419063.1.79836 WP_003419063.1.79956 WP_003419063.1.80052 WP_003419063.1.80144 WP_003419063.1.80342 WP_003419063.1.80379 WP_003419063.1.80455 WP_003419063.1.80504 WP_003419063.1.80575 WP_003419063.1.80610 WP_003419063.1.80963 WP_003419063.1.81035 WP_003419063.1.81044 WP_003419063.1.81208 WP_003419063.1.81299 WP_003419063.1.81351 WP_003419063.1.81402 WP_003419063.1.81605 WP_003419063.1.81777 WP_003419063.1.82084 WP_003419063.1.82169 WP_003419063.1.82335 WP_003419063.1.82635 WP_003419063.1.82701 WP_003419063.1.82920 WP_003419063.1.8314 WP_003419063.1.83148 WP_003419063.1.83175 WP_003419063.1.83255 WP_003419063.1.83287 WP_003419063.1.83288 WP_003419063.1.83318 WP_003419063.1.83348 WP_003419063.1.834 WP_003419063.1.83477 WP_003419063.1.83515 WP_003419063.1.83641 WP_003419063.1.83822 WP_003419063.1.83918 WP_003419063.1.84195 WP_003419063.1.84528 WP_003419063.1.84606 WP_003419063.1.84646 WP_003419063.1.84843 WP_003419063.1.84880 WP_003419063.1.84923 WP_003419063.1.85127 WP_003419063.1.85214 WP_003419063.1.85219 WP_003419063.1.8527 WP_003419063.1.85420 WP_003419063.1.85442 WP_003419063.1.85454 WP_003419063.1.85776 WP_003419063.1.85863 WP_003419063.1.8587 WP_003419063.1.85874 WP_003419063.1.85932 WP_003419063.1.86008 WP_003419063.1.86011 WP_003419063.1.86049 WP_003419063.1.86088 WP_003419063.1.86094 WP_003419063.1.86116 WP_003419063.1.86117 WP_003419063.1.86328 WP_003419063.1.86395 WP_003419063.1.86534 WP_003419063.1.86743 WP_003419063.1.86767 WP_003419063.1.86837 WP_003419063.1.86914 WP_003419063.1.87058 WP_003419063.1.87195 WP_003419063.1.87326 WP_003419063.1.87454 WP_003419063.1.87714 WP_003419063.1.87730 WP_003419063.1.87918 WP_003419063.1.87932 WP_003419063.1.88091 WP_003419063.1.882 WP_003419063.1.88268 WP_003419063.1.88332 WP_003419063.1.88364 WP_003419063.1.88372 WP_003419063.1.88377 WP_003419063.1.88608 WP_003419063.1.88996 WP_003419063.1.89052 WP_003419063.1.89065 WP_003419063.1.89196 WP_003419063.1.89337 WP_003419063.1.89364 WP_003419063.1.89457 WP_003419063.1.89629 WP_003419063.1.89697 WP_003419063.1.89994 WP_003419063.1.90076 WP_003419063.1.90101 WP_003419063.1.90164 WP_003419063.1.9041 WP_003419063.1.90491 WP_003419063.1.90555 WP_003419063.1.90643 WP_003419063.1.9083 WP_003419063.1.90921 WP_003419063.1.90938 WP_003419063.1.90981 WP_003419063.1.91065 WP_003419063.1.91254 WP_003419063.1.91314 WP_003419063.1.91406 WP_003419063.1.91648 WP_003419063.1.92075 WP_003419063.1.92284 WP_003419063.1.92371 WP_003419063.1.92576 WP_003419063.1.92658 WP_003419063.1.92941 WP_003419063.1.93044 WP_003419063.1.93171 WP_003419063.1.93360 WP_003419063.1.93480 WP_003419063.1.93615 WP_003419063.1.93687 WP_003419063.1.93717 WP_003419063.1.93766 WP_003419063.1.93782 WP_003419063.1.93798 WP_003419063.1.93802 WP_003419063.1.93830 WP_003419063.1.9393 WP_003419063.1.94073 WP_003419063.1.94166 WP_003419063.1.94427 WP_003419063.1.94768 WP_003419063.1.94968 WP_003419063.1.95095 WP_003419063.1.9522 WP_003419063.1.95350 WP_003419063.1.9580 WP_003419063.1.95847 WP_003419063.1.95893 WP_003419063.1.96113 WP_003419063.1.9635 WP_003419063.1.96503 WP_003419063.1.96505 WP_003419063.1.9666 WP_003419063.1.96690 WP_003419063.1.96765 WP_003419063.1.97219 WP_003419063.1.97432 WP_003419063.1.97458 WP_003419063.1.97672 WP_003419063.1.97806 WP_003419063.1.98037 WP_003419063.1.98514 WP_003419063.1.98622 WP_003419063.1.98698 WP_003419063.1.98715 WP_003419063.1.98748 WP_003419063.1.98856 WP_003419063.1.98997 WP_003419063.1.99064 WP_003419063.1.99134 WP_003419063.1.99333 WP_003419063.1.99542 WP_003419063.1.99545 WP_003419063.1.99731 WP_003419063.1.9986 YP_001087646.1.32744 272563.CD1154 645462.CD196_1013 645463.CDR20291_0991 gi|260682759|ref|YP_003214044.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]