SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260682885|ref|YP_003214170.1| from Clostridium difficile CD196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260682885|ref|YP_003214170.1|
Domain Number 1 Region: 2-135
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.42e-36
Family Z-DNA binding domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|260682885|ref|YP_003214170.1|
Sequence length 148
Comment RRF2 family transcriptional regulator [Clostridium difficile CD196]
Sequence
MKLSTKGRYGLKAMFELALNQDNGPVSLKFIAKKQKISDQYLEQIFSSLKKSGLVKSVRG
AQGGYLLSKNAEDITVGDILVVLEGPVALSDCVLDEDVCENSNMCVTKIVWEKMKKGIED
VIDSITLKDMINDYNKNKLENDITNIKK
Download sequence
Identical sequences A0A031WDR1 A0A0H3N5T9 A0A0J0UBP4 A0A125V4R1 A0A1F2CTI1 A0A2I2JS83 C9YKL6 D5Q5S7 D5S2S9 G6B7N6 G6BMM4 Q18BD8 T3DHC7 T4HXH4 U3ULR4 U3V6L1 U3VIW3
gi|260682885|ref|YP_003214170.1| gi|126698875|ref|YP_001087772.1| WP_003419409.1.100055 WP_003419409.1.100097 WP_003419409.1.100099 WP_003419409.1.100107 WP_003419409.1.100118 WP_003419409.1.100139 WP_003419409.1.100513 WP_003419409.1.100570 WP_003419409.1.100660 WP_003419409.1.100831 WP_003419409.1.100923 WP_003419409.1.100977 WP_003419409.1.101035 WP_003419409.1.101125 WP_003419409.1.101279 WP_003419409.1.10130 WP_003419409.1.101316 WP_003419409.1.101532 WP_003419409.1.101861 WP_003419409.1.101929 WP_003419409.1.102031 WP_003419409.1.102074 WP_003419409.1.102095 WP_003419409.1.10483 WP_003419409.1.10488 WP_003419409.1.10582 WP_003419409.1.10691 WP_003419409.1.10793 WP_003419409.1.10795 WP_003419409.1.11025 WP_003419409.1.11134 WP_003419409.1.11224 WP_003419409.1.11278 WP_003419409.1.11320 WP_003419409.1.11372 WP_003419409.1.11398 WP_003419409.1.1167 WP_003419409.1.1179 WP_003419409.1.11937 WP_003419409.1.11954 WP_003419409.1.11959 WP_003419409.1.12066 WP_003419409.1.12169 WP_003419409.1.12385 WP_003419409.1.1254 WP_003419409.1.12629 WP_003419409.1.12632 WP_003419409.1.12659 WP_003419409.1.1273 WP_003419409.1.12734 WP_003419409.1.12807 WP_003419409.1.12809 WP_003419409.1.12953 WP_003419409.1.13040 WP_003419409.1.13251 WP_003419409.1.13273 WP_003419409.1.13398 WP_003419409.1.13418 WP_003419409.1.13730 WP_003419409.1.13823 WP_003419409.1.13841 WP_003419409.1.13859 WP_003419409.1.14045 WP_003419409.1.141 WP_003419409.1.14170 WP_003419409.1.14177 WP_003419409.1.14205 WP_003419409.1.1422 WP_003419409.1.14259 WP_003419409.1.14330 WP_003419409.1.14352 WP_003419409.1.1445 WP_003419409.1.14457 WP_003419409.1.14483 WP_003419409.1.14579 WP_003419409.1.14674 WP_003419409.1.14686 WP_003419409.1.14698 WP_003419409.1.14848 WP_003419409.1.1494 WP_003419409.1.15083 WP_003419409.1.15097 WP_003419409.1.15192 WP_003419409.1.15205 WP_003419409.1.15310 WP_003419409.1.15435 WP_003419409.1.15908 WP_003419409.1.16012 WP_003419409.1.16135 WP_003419409.1.16185 WP_003419409.1.16190 WP_003419409.1.16376 WP_003419409.1.16520 WP_003419409.1.16728 WP_003419409.1.16897 WP_003419409.1.169 WP_003419409.1.16931 WP_003419409.1.16966 WP_003419409.1.1705 WP_003419409.1.17371 WP_003419409.1.17413 WP_003419409.1.17463 WP_003419409.1.17512 WP_003419409.1.17611 WP_003419409.1.17638 WP_003419409.1.17808 WP_003419409.1.17851 WP_003419409.1.17879 WP_003419409.1.17908 WP_003419409.1.17960 WP_003419409.1.17998 WP_003419409.1.18060 WP_003419409.1.18207 WP_003419409.1.18212 WP_003419409.1.18298 WP_003419409.1.1838 WP_003419409.1.18407 WP_003419409.1.18455 WP_003419409.1.18462 WP_003419409.1.18551 WP_003419409.1.18680 WP_003419409.1.18805 WP_003419409.1.18970 WP_003419409.1.19088 WP_003419409.1.19152 WP_003419409.1.1926 WP_003419409.1.19290 WP_003419409.1.1934 WP_003419409.1.19627 WP_003419409.1.19648 WP_003419409.1.19704 WP_003419409.1.19899 WP_003419409.1.19956 WP_003419409.1.1999 WP_003419409.1.2002 WP_003419409.1.20132 WP_003419409.1.20184 WP_003419409.1.20302 WP_003419409.1.20313 WP_003419409.1.20481 WP_003419409.1.20650 WP_003419409.1.20728 WP_003419409.1.20872 WP_003419409.1.20875 WP_003419409.1.20960 WP_003419409.1.21000 WP_003419409.1.21048 WP_003419409.1.21201 WP_003419409.1.21220 WP_003419409.1.21417 WP_003419409.1.21502 WP_003419409.1.21520 WP_003419409.1.21547 WP_003419409.1.21618 WP_003419409.1.21704 WP_003419409.1.21893 WP_003419409.1.21925 WP_003419409.1.21980 WP_003419409.1.22020 WP_003419409.1.22079 WP_003419409.1.22128 WP_003419409.1.22222 WP_003419409.1.22228 WP_003419409.1.22313 WP_003419409.1.22357 WP_003419409.1.22395 WP_003419409.1.22411 WP_003419409.1.22417 WP_003419409.1.22568 WP_003419409.1.22569 WP_003419409.1.22615 WP_003419409.1.22768 WP_003419409.1.22893 WP_003419409.1.22937 WP_003419409.1.23096 WP_003419409.1.23208 WP_003419409.1.23287 WP_003419409.1.23338 WP_003419409.1.2363 WP_003419409.1.24197 WP_003419409.1.24457 WP_003419409.1.24520 WP_003419409.1.24826 WP_003419409.1.24889 WP_003419409.1.24900 WP_003419409.1.24987 WP_003419409.1.25128 WP_003419409.1.25416 WP_003419409.1.25761 WP_003419409.1.26024 WP_003419409.1.26044 WP_003419409.1.26358 WP_003419409.1.26482 WP_003419409.1.26494 WP_003419409.1.26697 WP_003419409.1.26829 WP_003419409.1.26940 WP_003419409.1.27300 WP_003419409.1.27563 WP_003419409.1.2758 WP_003419409.1.27677 WP_003419409.1.27708 WP_003419409.1.27824 WP_003419409.1.27872 WP_003419409.1.27881 WP_003419409.1.27890 WP_003419409.1.27967 WP_003419409.1.27989 WP_003419409.1.27996 WP_003419409.1.28055 WP_003419409.1.28410 WP_003419409.1.28638 WP_003419409.1.28715 WP_003419409.1.28856 WP_003419409.1.28882 WP_003419409.1.28890 WP_003419409.1.28930 WP_003419409.1.2923 WP_003419409.1.293 WP_003419409.1.29600 WP_003419409.1.29757 WP_003419409.1.2982 WP_003419409.1.29891 WP_003419409.1.29939 WP_003419409.1.3014 WP_003419409.1.3024 WP_003419409.1.303 WP_003419409.1.3031 WP_003419409.1.30420 WP_003419409.1.30431 WP_003419409.1.30463 WP_003419409.1.30519 WP_003419409.1.30521 WP_003419409.1.30743 WP_003419409.1.30841 WP_003419409.1.30953 WP_003419409.1.31160 WP_003419409.1.31183 WP_003419409.1.31203 WP_003419409.1.31292 WP_003419409.1.31309 WP_003419409.1.31351 WP_003419409.1.31385 WP_003419409.1.31453 WP_003419409.1.31475 WP_003419409.1.31477 WP_003419409.1.31519 WP_003419409.1.31637 WP_003419409.1.31719 WP_003419409.1.31742 WP_003419409.1.31960 WP_003419409.1.31969 WP_003419409.1.32008 WP_003419409.1.32066 WP_003419409.1.32119 WP_003419409.1.32166 WP_003419409.1.32197 WP_003419409.1.32218 WP_003419409.1.32230 WP_003419409.1.32294 WP_003419409.1.32699 WP_003419409.1.32769 WP_003419409.1.32776 WP_003419409.1.32842 WP_003419409.1.32953 WP_003419409.1.33056 WP_003419409.1.33098 WP_003419409.1.33164 WP_003419409.1.33275 WP_003419409.1.33298 WP_003419409.1.33332 WP_003419409.1.33349 WP_003419409.1.3340 WP_003419409.1.33514 WP_003419409.1.33810 WP_003419409.1.34388 WP_003419409.1.34489 WP_003419409.1.34545 WP_003419409.1.34641 WP_003419409.1.34800 WP_003419409.1.34985 WP_003419409.1.34989 WP_003419409.1.35 WP_003419409.1.35002 WP_003419409.1.35137 WP_003419409.1.35181 WP_003419409.1.35187 WP_003419409.1.35234 WP_003419409.1.3559 WP_003419409.1.35709 WP_003419409.1.35832 WP_003419409.1.35884 WP_003419409.1.36078 WP_003419409.1.36257 WP_003419409.1.36338 WP_003419409.1.36738 WP_003419409.1.36835 WP_003419409.1.37255 WP_003419409.1.374 WP_003419409.1.37493 WP_003419409.1.37532 WP_003419409.1.37597 WP_003419409.1.37861 WP_003419409.1.3789 WP_003419409.1.37957 WP_003419409.1.37981 WP_003419409.1.38305 WP_003419409.1.38338 WP_003419409.1.38692 WP_003419409.1.38775 WP_003419409.1.38814 WP_003419409.1.38874 WP_003419409.1.38924 WP_003419409.1.38986 WP_003419409.1.39008 WP_003419409.1.3913 WP_003419409.1.39213 WP_003419409.1.39350 WP_003419409.1.39382 WP_003419409.1.39442 WP_003419409.1.39525 WP_003419409.1.39621 WP_003419409.1.39783 WP_003419409.1.39874 WP_003419409.1.39876 WP_003419409.1.39975 WP_003419409.1.39981 WP_003419409.1.40030 WP_003419409.1.40294 WP_003419409.1.40313 WP_003419409.1.40447 WP_003419409.1.40516 WP_003419409.1.40522 WP_003419409.1.40557 WP_003419409.1.407 WP_003419409.1.40775 WP_003419409.1.40891 WP_003419409.1.40959 WP_003419409.1.40966 WP_003419409.1.41131 WP_003419409.1.4121 WP_003419409.1.41334 WP_003419409.1.41342 WP_003419409.1.4137 WP_003419409.1.41506 WP_003419409.1.41534 WP_003419409.1.41641 WP_003419409.1.41687 WP_003419409.1.41818 WP_003419409.1.41995 WP_003419409.1.42035 WP_003419409.1.4204 WP_003419409.1.42066 WP_003419409.1.42532 WP_003419409.1.42533 WP_003419409.1.42610 WP_003419409.1.42664 WP_003419409.1.43112 WP_003419409.1.4315 WP_003419409.1.4321 WP_003419409.1.43388 WP_003419409.1.43490 WP_003419409.1.43519 WP_003419409.1.43579 WP_003419409.1.43663 WP_003419409.1.43824 WP_003419409.1.4383 WP_003419409.1.44030 WP_003419409.1.44105 WP_003419409.1.44149 WP_003419409.1.44198 WP_003419409.1.44241 WP_003419409.1.44470 WP_003419409.1.44471 WP_003419409.1.44729 WP_003419409.1.45017 WP_003419409.1.45059 WP_003419409.1.45142 WP_003419409.1.45165 WP_003419409.1.45209 WP_003419409.1.45257 WP_003419409.1.45352 WP_003419409.1.45554 WP_003419409.1.4573 WP_003419409.1.45938 WP_003419409.1.45986 WP_003419409.1.46066 WP_003419409.1.46117 WP_003419409.1.46274 WP_003419409.1.46280 WP_003419409.1.46305 WP_003419409.1.46522 WP_003419409.1.4698 WP_003419409.1.47016 WP_003419409.1.47121 WP_003419409.1.47173 WP_003419409.1.47227 WP_003419409.1.47228 WP_003419409.1.47479 WP_003419409.1.47615 WP_003419409.1.47708 WP_003419409.1.47729 WP_003419409.1.47940 WP_003419409.1.48220 WP_003419409.1.48246 WP_003419409.1.48279 WP_003419409.1.4835 WP_003419409.1.48491 WP_003419409.1.48733 WP_003419409.1.48746 WP_003419409.1.48772 WP_003419409.1.48935 WP_003419409.1.48980 WP_003419409.1.48983 WP_003419409.1.48991 WP_003419409.1.49020 WP_003419409.1.49054 WP_003419409.1.49065 WP_003419409.1.4908 WP_003419409.1.49092 WP_003419409.1.49230 WP_003419409.1.49310 WP_003419409.1.49339 WP_003419409.1.49451 WP_003419409.1.4948 WP_003419409.1.49633 WP_003419409.1.50159 WP_003419409.1.50341 WP_003419409.1.50460 WP_003419409.1.50495 WP_003419409.1.5073 WP_003419409.1.50865 WP_003419409.1.51007 WP_003419409.1.51166 WP_003419409.1.51235 WP_003419409.1.51675 WP_003419409.1.5187 WP_003419409.1.51996 WP_003419409.1.52073 WP_003419409.1.52132 WP_003419409.1.52164 WP_003419409.1.52266 WP_003419409.1.52278 WP_003419409.1.52294 WP_003419409.1.52311 WP_003419409.1.52330 WP_003419409.1.52383 WP_003419409.1.52402 WP_003419409.1.52466 WP_003419409.1.52525 WP_003419409.1.52789 WP_003419409.1.52958 WP_003419409.1.52997 WP_003419409.1.53008 WP_003419409.1.53044 WP_003419409.1.53055 WP_003419409.1.53288 WP_003419409.1.5337 WP_003419409.1.53504 WP_003419409.1.53704 WP_003419409.1.53710 WP_003419409.1.53729 WP_003419409.1.53987 WP_003419409.1.54058 WP_003419409.1.54153 WP_003419409.1.5423 WP_003419409.1.54262 WP_003419409.1.54350 WP_003419409.1.54586 WP_003419409.1.54593 WP_003419409.1.54692 WP_003419409.1.55055 WP_003419409.1.55101 WP_003419409.1.5521 WP_003419409.1.55302 WP_003419409.1.55371 WP_003419409.1.55391 WP_003419409.1.5558 WP_003419409.1.559 WP_003419409.1.56006 WP_003419409.1.56217 WP_003419409.1.56252 WP_003419409.1.56323 WP_003419409.1.56337 WP_003419409.1.56556 WP_003419409.1.5657 WP_003419409.1.5661 WP_003419409.1.5664 WP_003419409.1.56664 WP_003419409.1.56711 WP_003419409.1.56754 WP_003419409.1.56927 WP_003419409.1.56998 WP_003419409.1.57099 WP_003419409.1.57337 WP_003419409.1.5750 WP_003419409.1.57711 WP_003419409.1.57827 WP_003419409.1.58015 WP_003419409.1.58216 WP_003419409.1.58304 WP_003419409.1.58315 WP_003419409.1.58323 WP_003419409.1.58463 WP_003419409.1.58531 WP_003419409.1.58665 WP_003419409.1.58677 WP_003419409.1.58711 WP_003419409.1.58818 WP_003419409.1.58956 WP_003419409.1.59032 WP_003419409.1.5905 WP_003419409.1.59588 WP_003419409.1.59618 WP_003419409.1.59628 WP_003419409.1.59707 WP_003419409.1.59752 WP_003419409.1.59990 WP_003419409.1.60040 WP_003419409.1.6031 WP_003419409.1.60482 WP_003419409.1.60563 WP_003419409.1.6070 WP_003419409.1.60957 WP_003419409.1.60998 WP_003419409.1.61042 WP_003419409.1.61140 WP_003419409.1.61293 WP_003419409.1.61492 WP_003419409.1.61679 WP_003419409.1.61716 WP_003419409.1.61866 WP_003419409.1.61972 WP_003419409.1.62049 WP_003419409.1.62095 WP_003419409.1.62128 WP_003419409.1.62340 WP_003419409.1.62577 WP_003419409.1.62624 WP_003419409.1.62637 WP_003419409.1.62797 WP_003419409.1.62941 WP_003419409.1.62986 WP_003419409.1.63020 WP_003419409.1.63059 WP_003419409.1.63237 WP_003419409.1.63239 WP_003419409.1.63248 WP_003419409.1.63343 WP_003419409.1.63378 WP_003419409.1.63516 WP_003419409.1.63570 WP_003419409.1.63581 WP_003419409.1.63598 WP_003419409.1.63599 WP_003419409.1.63696 WP_003419409.1.63804 WP_003419409.1.63852 WP_003419409.1.63853 WP_003419409.1.63950 WP_003419409.1.64020 WP_003419409.1.64092 WP_003419409.1.64197 WP_003419409.1.64369 WP_003419409.1.64447 WP_003419409.1.64546 WP_003419409.1.64573 WP_003419409.1.64859 WP_003419409.1.65064 WP_003419409.1.65067 WP_003419409.1.65313 WP_003419409.1.65369 WP_003419409.1.65889 WP_003419409.1.66084 WP_003419409.1.66119 WP_003419409.1.66237 WP_003419409.1.66439 WP_003419409.1.66474 WP_003419409.1.66565 WP_003419409.1.66587 WP_003419409.1.66608 WP_003419409.1.66643 WP_003419409.1.66701 WP_003419409.1.6671 WP_003419409.1.6675 WP_003419409.1.66805 WP_003419409.1.66847 WP_003419409.1.6685 WP_003419409.1.66887 WP_003419409.1.66888 WP_003419409.1.66900 WP_003419409.1.670 WP_003419409.1.67303 WP_003419409.1.67308 WP_003419409.1.6736 WP_003419409.1.67368 WP_003419409.1.67528 WP_003419409.1.67689 WP_003419409.1.67695 WP_003419409.1.67711 WP_003419409.1.6792 WP_003419409.1.67951 WP_003419409.1.68150 WP_003419409.1.68276 WP_003419409.1.68322 WP_003419409.1.68955 WP_003419409.1.6898 WP_003419409.1.68980 WP_003419409.1.69114 WP_003419409.1.692 WP_003419409.1.69220 WP_003419409.1.69333 WP_003419409.1.69495 WP_003419409.1.69708 WP_003419409.1.6994 WP_003419409.1.700 WP_003419409.1.70152 WP_003419409.1.70179 WP_003419409.1.70231 WP_003419409.1.70320 WP_003419409.1.70464 WP_003419409.1.70695 WP_003419409.1.70710 WP_003419409.1.70820 WP_003419409.1.70886 WP_003419409.1.71079 WP_003419409.1.71119 WP_003419409.1.713 WP_003419409.1.71384 WP_003419409.1.71477 WP_003419409.1.7156 WP_003419409.1.71745 WP_003419409.1.7199 WP_003419409.1.72113 WP_003419409.1.72245 WP_003419409.1.72468 WP_003419409.1.72483 WP_003419409.1.72560 WP_003419409.1.72681 WP_003419409.1.72682 WP_003419409.1.72891 WP_003419409.1.72909 WP_003419409.1.72914 WP_003419409.1.72994 WP_003419409.1.73026 WP_003419409.1.73116 WP_003419409.1.7322 WP_003419409.1.73605 WP_003419409.1.73836 WP_003419409.1.73852 WP_003419409.1.73931 WP_003419409.1.74050 WP_003419409.1.74116 WP_003419409.1.74126 WP_003419409.1.74672 WP_003419409.1.74678 WP_003419409.1.74680 WP_003419409.1.74779 WP_003419409.1.74835 WP_003419409.1.74897 WP_003419409.1.75026 WP_003419409.1.751 WP_003419409.1.75210 WP_003419409.1.75226 WP_003419409.1.75287 WP_003419409.1.75454 WP_003419409.1.75638 WP_003419409.1.75659 WP_003419409.1.76072 WP_003419409.1.76207 WP_003419409.1.7650 WP_003419409.1.76550 WP_003419409.1.76552 WP_003419409.1.76603 WP_003419409.1.76621 WP_003419409.1.76664 WP_003419409.1.76687 WP_003419409.1.76793 WP_003419409.1.76813 WP_003419409.1.76882 WP_003419409.1.76924 WP_003419409.1.7696 WP_003419409.1.77092 WP_003419409.1.77102 WP_003419409.1.77473 WP_003419409.1.77509 WP_003419409.1.77544 WP_003419409.1.7755 WP_003419409.1.77639 WP_003419409.1.77782 WP_003419409.1.77842 WP_003419409.1.77942 WP_003419409.1.78123 WP_003419409.1.78579 WP_003419409.1.78949 WP_003419409.1.79123 WP_003419409.1.79125 WP_003419409.1.7916 WP_003419409.1.79199 WP_003419409.1.79221 WP_003419409.1.79309 WP_003419409.1.79344 WP_003419409.1.79437 WP_003419409.1.79611 WP_003419409.1.79673 WP_003419409.1.79680 WP_003419409.1.79703 WP_003419409.1.79836 WP_003419409.1.79956 WP_003419409.1.80052 WP_003419409.1.80144 WP_003419409.1.80342 WP_003419409.1.80379 WP_003419409.1.80455 WP_003419409.1.80504 WP_003419409.1.80575 WP_003419409.1.80610 WP_003419409.1.80963 WP_003419409.1.81035 WP_003419409.1.81044 WP_003419409.1.81208 WP_003419409.1.81299 WP_003419409.1.81351 WP_003419409.1.81402 WP_003419409.1.81605 WP_003419409.1.81777 WP_003419409.1.82002 WP_003419409.1.82084 WP_003419409.1.82150 WP_003419409.1.82169 WP_003419409.1.82335 WP_003419409.1.82635 WP_003419409.1.82701 WP_003419409.1.82920 WP_003419409.1.8314 WP_003419409.1.83175 WP_003419409.1.83255 WP_003419409.1.83287 WP_003419409.1.83288 WP_003419409.1.83318 WP_003419409.1.83348 WP_003419409.1.8336 WP_003419409.1.834 WP_003419409.1.83477 WP_003419409.1.83515 WP_003419409.1.83641 WP_003419409.1.83822 WP_003419409.1.83918 WP_003419409.1.84195 WP_003419409.1.84253 WP_003419409.1.84528 WP_003419409.1.84606 WP_003419409.1.84646 WP_003419409.1.84843 WP_003419409.1.84880 WP_003419409.1.84923 WP_003419409.1.85020 WP_003419409.1.85127 WP_003419409.1.85214 WP_003419409.1.85219 WP_003419409.1.8527 WP_003419409.1.85420 WP_003419409.1.85442 WP_003419409.1.85454 WP_003419409.1.85776 WP_003419409.1.85863 WP_003419409.1.8587 WP_003419409.1.85874 WP_003419409.1.85932 WP_003419409.1.86008 WP_003419409.1.86011 WP_003419409.1.86049 WP_003419409.1.86088 WP_003419409.1.86094 WP_003419409.1.86116 WP_003419409.1.86117 WP_003419409.1.86328 WP_003419409.1.86395 WP_003419409.1.86534 WP_003419409.1.86618 WP_003419409.1.86743 WP_003419409.1.86767 WP_003419409.1.86837 WP_003419409.1.86914 WP_003419409.1.87058 WP_003419409.1.87195 WP_003419409.1.87326 WP_003419409.1.87454 WP_003419409.1.87714 WP_003419409.1.87723 WP_003419409.1.87730 WP_003419409.1.87918 WP_003419409.1.87932 WP_003419409.1.88091 WP_003419409.1.882 WP_003419409.1.88268 WP_003419409.1.88332 WP_003419409.1.88364 WP_003419409.1.88372 WP_003419409.1.88377 WP_003419409.1.88608 WP_003419409.1.88640 WP_003419409.1.88996 WP_003419409.1.89052 WP_003419409.1.89065 WP_003419409.1.89196 WP_003419409.1.89337 WP_003419409.1.89364 WP_003419409.1.89457 WP_003419409.1.89541 WP_003419409.1.89629 WP_003419409.1.89697 WP_003419409.1.8984 WP_003419409.1.89994 WP_003419409.1.90076 WP_003419409.1.90101 WP_003419409.1.90164 WP_003419409.1.90329 WP_003419409.1.9041 WP_003419409.1.90491 WP_003419409.1.90555 WP_003419409.1.90643 WP_003419409.1.9083 WP_003419409.1.90921 WP_003419409.1.90938 WP_003419409.1.90981 WP_003419409.1.90985 WP_003419409.1.91065 WP_003419409.1.91254 WP_003419409.1.91314 WP_003419409.1.91406 WP_003419409.1.91570 WP_003419409.1.91648 WP_003419409.1.92075 WP_003419409.1.92284 WP_003419409.1.92371 WP_003419409.1.92576 WP_003419409.1.92658 WP_003419409.1.92697 WP_003419409.1.92941 WP_003419409.1.93044 WP_003419409.1.93171 WP_003419409.1.93313 WP_003419409.1.93360 WP_003419409.1.93480 WP_003419409.1.93615 WP_003419409.1.93687 WP_003419409.1.93717 WP_003419409.1.93766 WP_003419409.1.93782 WP_003419409.1.93798 WP_003419409.1.93802 WP_003419409.1.93830 WP_003419409.1.9393 WP_003419409.1.93968 WP_003419409.1.94067 WP_003419409.1.94073 WP_003419409.1.94166 WP_003419409.1.94427 WP_003419409.1.94768 WP_003419409.1.94831 WP_003419409.1.94968 WP_003419409.1.95095 WP_003419409.1.95173 WP_003419409.1.9522 WP_003419409.1.95350 WP_003419409.1.95517 WP_003419409.1.9580 WP_003419409.1.95847 WP_003419409.1.95893 WP_003419409.1.96113 WP_003419409.1.9635 WP_003419409.1.96503 WP_003419409.1.96505 WP_003419409.1.9666 WP_003419409.1.96690 WP_003419409.1.96765 WP_003419409.1.97219 WP_003419409.1.97432 WP_003419409.1.97458 WP_003419409.1.97672 WP_003419409.1.97682 WP_003419409.1.97806 WP_003419409.1.98037 WP_003419409.1.98514 WP_003419409.1.98622 WP_003419409.1.98698 WP_003419409.1.98715 WP_003419409.1.98748 WP_003419409.1.98856 WP_003419409.1.98913 WP_003419409.1.98997 WP_003419409.1.99064 WP_003419409.1.99134 WP_003419409.1.99333 WP_003419409.1.99542 WP_003419409.1.99545 WP_003419409.1.99731 WP_003419409.1.9986 YP_001087772.1.32744 396887 gi|260686483|ref|YP_003217616.1| 272563.CD1278 645462.CD196_1140 645463.CDR20291_1118 gi|384360474|ref|YP_006198326.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]