SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260682894|ref|YP_003214179.1| from Clostridium difficile CD196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260682894|ref|YP_003214179.1|
Domain Number 1 Region: 9-142
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.87e-39
Family FUR-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|260682894|ref|YP_003214179.1|
Sequence length 152
Comment ferric uptake regulation protein [Clostridium difficile CD196]
Sequence
MANTMDLLKDKLKETGFKITPQRRAIVEILLKHDHSHLSSEEIYDLVRVDCPEIGLATVY
RTMQLLDEIGLISKLNLDDGCIRYEISLHKEDCHNHHHLICKNCGKIMEAKEDLLDNIEK
EIQSLYKFKILDHDVKFYGLCDECNGVSDSEE
Download sequence
Identical sequences A0A031WD82 A0A0H3N166 A0A125V4G6 A0A1F2CTR6 A0A2I2JSC2 C9YKM5 D5Q5T6 D5S2S0 G6B7M7 G6BML5 Q18BE9 T4HXE9 U3UM56 U3V7Z3 U3VHY3
gi|260686492|ref|YP_003217625.1| WP_003419428.1.100055 WP_003419428.1.100097 WP_003419428.1.100099 WP_003419428.1.100107 WP_003419428.1.100118 WP_003419428.1.100139 WP_003419428.1.100513 WP_003419428.1.100570 WP_003419428.1.100660 WP_003419428.1.100831 WP_003419428.1.100923 WP_003419428.1.100977 WP_003419428.1.101035 WP_003419428.1.101125 WP_003419428.1.101279 WP_003419428.1.10130 WP_003419428.1.101316 WP_003419428.1.101532 WP_003419428.1.101861 WP_003419428.1.101929 WP_003419428.1.102031 WP_003419428.1.102074 WP_003419428.1.102095 WP_003419428.1.10483 WP_003419428.1.10488 WP_003419428.1.10582 WP_003419428.1.10691 WP_003419428.1.10793 WP_003419428.1.11025 WP_003419428.1.11224 WP_003419428.1.11278 WP_003419428.1.11320 WP_003419428.1.11372 WP_003419428.1.11398 WP_003419428.1.1167 WP_003419428.1.1179 WP_003419428.1.11937 WP_003419428.1.11954 WP_003419428.1.11959 WP_003419428.1.12066 WP_003419428.1.12169 WP_003419428.1.12385 WP_003419428.1.1254 WP_003419428.1.12629 WP_003419428.1.12632 WP_003419428.1.12659 WP_003419428.1.1273 WP_003419428.1.12734 WP_003419428.1.12807 WP_003419428.1.12809 WP_003419428.1.12953 WP_003419428.1.13040 WP_003419428.1.13251 WP_003419428.1.13273 WP_003419428.1.13398 WP_003419428.1.13418 WP_003419428.1.13730 WP_003419428.1.13823 WP_003419428.1.13841 WP_003419428.1.13859 WP_003419428.1.14045 WP_003419428.1.141 WP_003419428.1.14170 WP_003419428.1.14177 WP_003419428.1.14205 WP_003419428.1.1422 WP_003419428.1.14259 WP_003419428.1.14330 WP_003419428.1.14352 WP_003419428.1.1445 WP_003419428.1.14457 WP_003419428.1.14483 WP_003419428.1.14579 WP_003419428.1.14674 WP_003419428.1.14686 WP_003419428.1.14698 WP_003419428.1.14848 WP_003419428.1.1494 WP_003419428.1.15083 WP_003419428.1.15097 WP_003419428.1.15192 WP_003419428.1.15205 WP_003419428.1.15310 WP_003419428.1.15435 WP_003419428.1.15908 WP_003419428.1.16012 WP_003419428.1.16135 WP_003419428.1.16185 WP_003419428.1.16376 WP_003419428.1.16520 WP_003419428.1.16728 WP_003419428.1.16897 WP_003419428.1.169 WP_003419428.1.16931 WP_003419428.1.16966 WP_003419428.1.1705 WP_003419428.1.17371 WP_003419428.1.17413 WP_003419428.1.17463 WP_003419428.1.17512 WP_003419428.1.17611 WP_003419428.1.17638 WP_003419428.1.17808 WP_003419428.1.17851 WP_003419428.1.17879 WP_003419428.1.17908 WP_003419428.1.17960 WP_003419428.1.17998 WP_003419428.1.18060 WP_003419428.1.18207 WP_003419428.1.18212 WP_003419428.1.18298 WP_003419428.1.1838 WP_003419428.1.18407 WP_003419428.1.18455 WP_003419428.1.18462 WP_003419428.1.18551 WP_003419428.1.18680 WP_003419428.1.18805 WP_003419428.1.18970 WP_003419428.1.19088 WP_003419428.1.19152 WP_003419428.1.1926 WP_003419428.1.19290 WP_003419428.1.1934 WP_003419428.1.19648 WP_003419428.1.19704 WP_003419428.1.19899 WP_003419428.1.19956 WP_003419428.1.1999 WP_003419428.1.2002 WP_003419428.1.20132 WP_003419428.1.20184 WP_003419428.1.20302 WP_003419428.1.20313 WP_003419428.1.20481 WP_003419428.1.20650 WP_003419428.1.20728 WP_003419428.1.20872 WP_003419428.1.20875 WP_003419428.1.20960 WP_003419428.1.21000 WP_003419428.1.21048 WP_003419428.1.21201 WP_003419428.1.21220 WP_003419428.1.21417 WP_003419428.1.21502 WP_003419428.1.21520 WP_003419428.1.21547 WP_003419428.1.21618 WP_003419428.1.21704 WP_003419428.1.21893 WP_003419428.1.21925 WP_003419428.1.21980 WP_003419428.1.22020 WP_003419428.1.22079 WP_003419428.1.22128 WP_003419428.1.22222 WP_003419428.1.22228 WP_003419428.1.22313 WP_003419428.1.22357 WP_003419428.1.22395 WP_003419428.1.22411 WP_003419428.1.22417 WP_003419428.1.22568 WP_003419428.1.22569 WP_003419428.1.22615 WP_003419428.1.22768 WP_003419428.1.22893 WP_003419428.1.22937 WP_003419428.1.23096 WP_003419428.1.23208 WP_003419428.1.23287 WP_003419428.1.23338 WP_003419428.1.2363 WP_003419428.1.24197 WP_003419428.1.24457 WP_003419428.1.24520 WP_003419428.1.24826 WP_003419428.1.24889 WP_003419428.1.24900 WP_003419428.1.24987 WP_003419428.1.25128 WP_003419428.1.25416 WP_003419428.1.25761 WP_003419428.1.26024 WP_003419428.1.26044 WP_003419428.1.26358 WP_003419428.1.26482 WP_003419428.1.26494 WP_003419428.1.26697 WP_003419428.1.26829 WP_003419428.1.26940 WP_003419428.1.27300 WP_003419428.1.2758 WP_003419428.1.27677 WP_003419428.1.27708 WP_003419428.1.27824 WP_003419428.1.27872 WP_003419428.1.27881 WP_003419428.1.27890 WP_003419428.1.27967 WP_003419428.1.27989 WP_003419428.1.27996 WP_003419428.1.28055 WP_003419428.1.28410 WP_003419428.1.28638 WP_003419428.1.28715 WP_003419428.1.28856 WP_003419428.1.28882 WP_003419428.1.28890 WP_003419428.1.28930 WP_003419428.1.2923 WP_003419428.1.293 WP_003419428.1.29600 WP_003419428.1.29757 WP_003419428.1.2982 WP_003419428.1.29891 WP_003419428.1.29939 WP_003419428.1.3024 WP_003419428.1.303 WP_003419428.1.3031 WP_003419428.1.30420 WP_003419428.1.30431 WP_003419428.1.30463 WP_003419428.1.30519 WP_003419428.1.30521 WP_003419428.1.30743 WP_003419428.1.30841 WP_003419428.1.30953 WP_003419428.1.31160 WP_003419428.1.31183 WP_003419428.1.31203 WP_003419428.1.31292 WP_003419428.1.31309 WP_003419428.1.31351 WP_003419428.1.31385 WP_003419428.1.31453 WP_003419428.1.31475 WP_003419428.1.31477 WP_003419428.1.31519 WP_003419428.1.31637 WP_003419428.1.31719 WP_003419428.1.31742 WP_003419428.1.31960 WP_003419428.1.31969 WP_003419428.1.32008 WP_003419428.1.32066 WP_003419428.1.32119 WP_003419428.1.32166 WP_003419428.1.32197 WP_003419428.1.32218 WP_003419428.1.32230 WP_003419428.1.32294 WP_003419428.1.32699 WP_003419428.1.32769 WP_003419428.1.32776 WP_003419428.1.32842 WP_003419428.1.32953 WP_003419428.1.33056 WP_003419428.1.33098 WP_003419428.1.33164 WP_003419428.1.33275 WP_003419428.1.33298 WP_003419428.1.33332 WP_003419428.1.33349 WP_003419428.1.3340 WP_003419428.1.33514 WP_003419428.1.33810 WP_003419428.1.34388 WP_003419428.1.34489 WP_003419428.1.34545 WP_003419428.1.34641 WP_003419428.1.34800 WP_003419428.1.34985 WP_003419428.1.34989 WP_003419428.1.35 WP_003419428.1.35002 WP_003419428.1.35137 WP_003419428.1.35181 WP_003419428.1.35187 WP_003419428.1.35234 WP_003419428.1.3559 WP_003419428.1.35832 WP_003419428.1.35884 WP_003419428.1.36078 WP_003419428.1.36257 WP_003419428.1.36338 WP_003419428.1.36738 WP_003419428.1.36835 WP_003419428.1.37255 WP_003419428.1.374 WP_003419428.1.37493 WP_003419428.1.37532 WP_003419428.1.37597 WP_003419428.1.37861 WP_003419428.1.3789 WP_003419428.1.37957 WP_003419428.1.37981 WP_003419428.1.38305 WP_003419428.1.38338 WP_003419428.1.38692 WP_003419428.1.38775 WP_003419428.1.38814 WP_003419428.1.38874 WP_003419428.1.38924 WP_003419428.1.38986 WP_003419428.1.39008 WP_003419428.1.3913 WP_003419428.1.39213 WP_003419428.1.39350 WP_003419428.1.39382 WP_003419428.1.39442 WP_003419428.1.39525 WP_003419428.1.39621 WP_003419428.1.39783 WP_003419428.1.39874 WP_003419428.1.39876 WP_003419428.1.39975 WP_003419428.1.39981 WP_003419428.1.40030 WP_003419428.1.40294 WP_003419428.1.40313 WP_003419428.1.40447 WP_003419428.1.40516 WP_003419428.1.40522 WP_003419428.1.40557 WP_003419428.1.407 WP_003419428.1.40775 WP_003419428.1.40891 WP_003419428.1.40959 WP_003419428.1.40966 WP_003419428.1.41131 WP_003419428.1.4121 WP_003419428.1.41334 WP_003419428.1.41342 WP_003419428.1.4137 WP_003419428.1.41506 WP_003419428.1.41534 WP_003419428.1.41641 WP_003419428.1.41687 WP_003419428.1.41818 WP_003419428.1.41995 WP_003419428.1.42035 WP_003419428.1.4204 WP_003419428.1.42066 WP_003419428.1.42532 WP_003419428.1.42533 WP_003419428.1.42610 WP_003419428.1.42664 WP_003419428.1.43112 WP_003419428.1.4315 WP_003419428.1.4321 WP_003419428.1.43388 WP_003419428.1.43490 WP_003419428.1.43519 WP_003419428.1.43579 WP_003419428.1.43663 WP_003419428.1.43824 WP_003419428.1.4383 WP_003419428.1.44030 WP_003419428.1.44105 WP_003419428.1.44149 WP_003419428.1.44198 WP_003419428.1.44241 WP_003419428.1.44470 WP_003419428.1.44471 WP_003419428.1.44729 WP_003419428.1.45017 WP_003419428.1.45059 WP_003419428.1.45142 WP_003419428.1.45165 WP_003419428.1.45209 WP_003419428.1.45257 WP_003419428.1.45352 WP_003419428.1.45554 WP_003419428.1.4573 WP_003419428.1.45938 WP_003419428.1.45986 WP_003419428.1.46066 WP_003419428.1.46117 WP_003419428.1.46274 WP_003419428.1.46280 WP_003419428.1.46305 WP_003419428.1.46522 WP_003419428.1.4698 WP_003419428.1.47016 WP_003419428.1.47121 WP_003419428.1.47173 WP_003419428.1.47227 WP_003419428.1.47228 WP_003419428.1.47479 WP_003419428.1.47615 WP_003419428.1.47708 WP_003419428.1.47729 WP_003419428.1.47940 WP_003419428.1.48220 WP_003419428.1.48246 WP_003419428.1.48279 WP_003419428.1.4835 WP_003419428.1.48491 WP_003419428.1.48746 WP_003419428.1.48772 WP_003419428.1.48935 WP_003419428.1.48980 WP_003419428.1.48983 WP_003419428.1.48991 WP_003419428.1.49020 WP_003419428.1.49054 WP_003419428.1.49065 WP_003419428.1.4908 WP_003419428.1.49092 WP_003419428.1.49230 WP_003419428.1.49310 WP_003419428.1.49339 WP_003419428.1.49451 WP_003419428.1.4948 WP_003419428.1.49633 WP_003419428.1.50159 WP_003419428.1.50341 WP_003419428.1.50460 WP_003419428.1.50495 WP_003419428.1.5073 WP_003419428.1.50865 WP_003419428.1.51007 WP_003419428.1.51166 WP_003419428.1.51235 WP_003419428.1.51675 WP_003419428.1.5187 WP_003419428.1.51996 WP_003419428.1.52073 WP_003419428.1.52164 WP_003419428.1.52266 WP_003419428.1.52278 WP_003419428.1.52294 WP_003419428.1.52311 WP_003419428.1.52330 WP_003419428.1.52383 WP_003419428.1.52402 WP_003419428.1.52466 WP_003419428.1.52525 WP_003419428.1.52789 WP_003419428.1.52958 WP_003419428.1.52997 WP_003419428.1.53008 WP_003419428.1.53044 WP_003419428.1.53055 WP_003419428.1.53288 WP_003419428.1.5337 WP_003419428.1.53504 WP_003419428.1.53704 WP_003419428.1.53710 WP_003419428.1.53729 WP_003419428.1.53987 WP_003419428.1.54058 WP_003419428.1.54153 WP_003419428.1.5423 WP_003419428.1.54262 WP_003419428.1.54350 WP_003419428.1.54586 WP_003419428.1.54593 WP_003419428.1.54692 WP_003419428.1.55055 WP_003419428.1.55101 WP_003419428.1.5521 WP_003419428.1.55302 WP_003419428.1.55371 WP_003419428.1.55391 WP_003419428.1.5558 WP_003419428.1.559 WP_003419428.1.56006 WP_003419428.1.56217 WP_003419428.1.56252 WP_003419428.1.56323 WP_003419428.1.56337 WP_003419428.1.56556 WP_003419428.1.5657 WP_003419428.1.5661 WP_003419428.1.5664 WP_003419428.1.56664 WP_003419428.1.56711 WP_003419428.1.56754 WP_003419428.1.56927 WP_003419428.1.56998 WP_003419428.1.57099 WP_003419428.1.57337 WP_003419428.1.5750 WP_003419428.1.57711 WP_003419428.1.57827 WP_003419428.1.58015 WP_003419428.1.58216 WP_003419428.1.58304 WP_003419428.1.58315 WP_003419428.1.58323 WP_003419428.1.58463 WP_003419428.1.58531 WP_003419428.1.58665 WP_003419428.1.58677 WP_003419428.1.58711 WP_003419428.1.58818 WP_003419428.1.58956 WP_003419428.1.59032 WP_003419428.1.5905 WP_003419428.1.59588 WP_003419428.1.59618 WP_003419428.1.59628 WP_003419428.1.59707 WP_003419428.1.59752 WP_003419428.1.59990 WP_003419428.1.60040 WP_003419428.1.6031 WP_003419428.1.60482 WP_003419428.1.60563 WP_003419428.1.60957 WP_003419428.1.60998 WP_003419428.1.61042 WP_003419428.1.61140 WP_003419428.1.61293 WP_003419428.1.61492 WP_003419428.1.61679 WP_003419428.1.61716 WP_003419428.1.61866 WP_003419428.1.61972 WP_003419428.1.62049 WP_003419428.1.62095 WP_003419428.1.62128 WP_003419428.1.62340 WP_003419428.1.62577 WP_003419428.1.62624 WP_003419428.1.62637 WP_003419428.1.62797 WP_003419428.1.62941 WP_003419428.1.62986 WP_003419428.1.63020 WP_003419428.1.63059 WP_003419428.1.63237 WP_003419428.1.63239 WP_003419428.1.63248 WP_003419428.1.63343 WP_003419428.1.63378 WP_003419428.1.63516 WP_003419428.1.63570 WP_003419428.1.63581 WP_003419428.1.63598 WP_003419428.1.63599 WP_003419428.1.63696 WP_003419428.1.63804 WP_003419428.1.63852 WP_003419428.1.63853 WP_003419428.1.64020 WP_003419428.1.64092 WP_003419428.1.64197 WP_003419428.1.64369 WP_003419428.1.64447 WP_003419428.1.64546 WP_003419428.1.64573 WP_003419428.1.64859 WP_003419428.1.65064 WP_003419428.1.65067 WP_003419428.1.65369 WP_003419428.1.65889 WP_003419428.1.66084 WP_003419428.1.66119 WP_003419428.1.66237 WP_003419428.1.66439 WP_003419428.1.66474 WP_003419428.1.66565 WP_003419428.1.66587 WP_003419428.1.66608 WP_003419428.1.66643 WP_003419428.1.66701 WP_003419428.1.6671 WP_003419428.1.6675 WP_003419428.1.66805 WP_003419428.1.66847 WP_003419428.1.6685 WP_003419428.1.66887 WP_003419428.1.66888 WP_003419428.1.66900 WP_003419428.1.670 WP_003419428.1.67303 WP_003419428.1.67308 WP_003419428.1.6736 WP_003419428.1.67368 WP_003419428.1.67528 WP_003419428.1.67689 WP_003419428.1.67695 WP_003419428.1.67711 WP_003419428.1.6792 WP_003419428.1.67951 WP_003419428.1.68150 WP_003419428.1.68276 WP_003419428.1.68322 WP_003419428.1.68955 WP_003419428.1.68980 WP_003419428.1.69114 WP_003419428.1.692 WP_003419428.1.69220 WP_003419428.1.69333 WP_003419428.1.69495 WP_003419428.1.69708 WP_003419428.1.6994 WP_003419428.1.700 WP_003419428.1.70152 WP_003419428.1.70179 WP_003419428.1.70231 WP_003419428.1.70320 WP_003419428.1.70464 WP_003419428.1.70695 WP_003419428.1.70710 WP_003419428.1.70820 WP_003419428.1.70886 WP_003419428.1.71079 WP_003419428.1.71119 WP_003419428.1.713 WP_003419428.1.71384 WP_003419428.1.71477 WP_003419428.1.7156 WP_003419428.1.71745 WP_003419428.1.7199 WP_003419428.1.72113 WP_003419428.1.72245 WP_003419428.1.72468 WP_003419428.1.72483 WP_003419428.1.72560 WP_003419428.1.72681 WP_003419428.1.72682 WP_003419428.1.72891 WP_003419428.1.72909 WP_003419428.1.72914 WP_003419428.1.72994 WP_003419428.1.73026 WP_003419428.1.73116 WP_003419428.1.7322 WP_003419428.1.73605 WP_003419428.1.73852 WP_003419428.1.73931 WP_003419428.1.74050 WP_003419428.1.74116 WP_003419428.1.74126 WP_003419428.1.74672 WP_003419428.1.74678 WP_003419428.1.74680 WP_003419428.1.74835 WP_003419428.1.74897 WP_003419428.1.75026 WP_003419428.1.751 WP_003419428.1.75210 WP_003419428.1.75226 WP_003419428.1.75287 WP_003419428.1.75454 WP_003419428.1.75638 WP_003419428.1.75659 WP_003419428.1.76207 WP_003419428.1.7650 WP_003419428.1.76550 WP_003419428.1.76552 WP_003419428.1.76603 WP_003419428.1.76621 WP_003419428.1.76664 WP_003419428.1.76687 WP_003419428.1.76793 WP_003419428.1.76813 WP_003419428.1.76882 WP_003419428.1.76924 WP_003419428.1.7696 WP_003419428.1.77092 WP_003419428.1.77102 WP_003419428.1.77473 WP_003419428.1.77509 WP_003419428.1.77544 WP_003419428.1.7755 WP_003419428.1.77639 WP_003419428.1.77782 WP_003419428.1.77842 WP_003419428.1.77942 WP_003419428.1.78123 WP_003419428.1.78579 WP_003419428.1.78949 WP_003419428.1.79125 WP_003419428.1.7916 WP_003419428.1.79199 WP_003419428.1.79221 WP_003419428.1.79309 WP_003419428.1.79344 WP_003419428.1.79437 WP_003419428.1.79611 WP_003419428.1.79673 WP_003419428.1.79680 WP_003419428.1.79703 WP_003419428.1.79836 WP_003419428.1.79956 WP_003419428.1.80052 WP_003419428.1.80144 WP_003419428.1.80342 WP_003419428.1.80379 WP_003419428.1.80455 WP_003419428.1.80575 WP_003419428.1.80610 WP_003419428.1.80963 WP_003419428.1.81035 WP_003419428.1.81044 WP_003419428.1.81208 WP_003419428.1.81299 WP_003419428.1.81351 WP_003419428.1.81402 WP_003419428.1.81605 WP_003419428.1.81777 WP_003419428.1.82002 WP_003419428.1.82084 WP_003419428.1.82150 WP_003419428.1.82169 WP_003419428.1.82335 WP_003419428.1.82635 WP_003419428.1.82701 WP_003419428.1.82920 WP_003419428.1.8314 WP_003419428.1.83148 WP_003419428.1.83175 WP_003419428.1.83255 WP_003419428.1.83287 WP_003419428.1.83288 WP_003419428.1.83318 WP_003419428.1.83348 WP_003419428.1.834 WP_003419428.1.83477 WP_003419428.1.83515 WP_003419428.1.83641 WP_003419428.1.83822 WP_003419428.1.83918 WP_003419428.1.84195 WP_003419428.1.84253 WP_003419428.1.84528 WP_003419428.1.84606 WP_003419428.1.84646 WP_003419428.1.84843 WP_003419428.1.84880 WP_003419428.1.84923 WP_003419428.1.85020 WP_003419428.1.85127 WP_003419428.1.85214 WP_003419428.1.85219 WP_003419428.1.8527 WP_003419428.1.85420 WP_003419428.1.85442 WP_003419428.1.85454 WP_003419428.1.85776 WP_003419428.1.85863 WP_003419428.1.8587 WP_003419428.1.85874 WP_003419428.1.85932 WP_003419428.1.86008 WP_003419428.1.86011 WP_003419428.1.86049 WP_003419428.1.86088 WP_003419428.1.86094 WP_003419428.1.86116 WP_003419428.1.86117 WP_003419428.1.86328 WP_003419428.1.86395 WP_003419428.1.86534 WP_003419428.1.86618 WP_003419428.1.86743 WP_003419428.1.86767 WP_003419428.1.86837 WP_003419428.1.86914 WP_003419428.1.87058 WP_003419428.1.87195 WP_003419428.1.87326 WP_003419428.1.87454 WP_003419428.1.87714 WP_003419428.1.87723 WP_003419428.1.87730 WP_003419428.1.87918 WP_003419428.1.87932 WP_003419428.1.88091 WP_003419428.1.882 WP_003419428.1.88268 WP_003419428.1.88332 WP_003419428.1.88364 WP_003419428.1.88372 WP_003419428.1.88377 WP_003419428.1.88608 WP_003419428.1.88996 WP_003419428.1.89052 WP_003419428.1.89065 WP_003419428.1.89196 WP_003419428.1.89337 WP_003419428.1.89364 WP_003419428.1.89457 WP_003419428.1.89541 WP_003419428.1.89629 WP_003419428.1.89697 WP_003419428.1.89994 WP_003419428.1.90076 WP_003419428.1.90101 WP_003419428.1.90164 WP_003419428.1.90329 WP_003419428.1.9041 WP_003419428.1.90491 WP_003419428.1.90555 WP_003419428.1.90643 WP_003419428.1.9083 WP_003419428.1.90921 WP_003419428.1.90938 WP_003419428.1.90981 WP_003419428.1.91065 WP_003419428.1.91254 WP_003419428.1.91314 WP_003419428.1.91406 WP_003419428.1.91570 WP_003419428.1.91648 WP_003419428.1.92075 WP_003419428.1.92284 WP_003419428.1.92371 WP_003419428.1.92576 WP_003419428.1.92658 WP_003419428.1.92697 WP_003419428.1.92941 WP_003419428.1.93044 WP_003419428.1.93171 WP_003419428.1.93313 WP_003419428.1.93360 WP_003419428.1.93480 WP_003419428.1.93615 WP_003419428.1.93687 WP_003419428.1.93717 WP_003419428.1.93766 WP_003419428.1.93782 WP_003419428.1.93798 WP_003419428.1.93802 WP_003419428.1.93830 WP_003419428.1.9393 WP_003419428.1.94067 WP_003419428.1.94073 WP_003419428.1.94166 WP_003419428.1.94427 WP_003419428.1.94768 WP_003419428.1.94831 WP_003419428.1.94968 WP_003419428.1.95095 WP_003419428.1.95173 WP_003419428.1.9522 WP_003419428.1.95350 WP_003419428.1.95517 WP_003419428.1.9580 WP_003419428.1.95847 WP_003419428.1.95893 WP_003419428.1.96113 WP_003419428.1.9635 WP_003419428.1.96503 WP_003419428.1.96505 WP_003419428.1.9666 WP_003419428.1.96690 WP_003419428.1.96765 WP_003419428.1.97219 WP_003419428.1.97432 WP_003419428.1.97458 WP_003419428.1.97672 WP_003419428.1.97682 WP_003419428.1.97806 WP_003419428.1.98037 WP_003419428.1.98514 WP_003419428.1.98622 WP_003419428.1.98698 WP_003419428.1.98715 WP_003419428.1.98748 WP_003419428.1.98856 WP_003419428.1.98913 WP_003419428.1.98997 WP_003419428.1.99064 WP_003419428.1.99134 WP_003419428.1.99333 WP_003419428.1.99542 WP_003419428.1.99545 WP_003419428.1.99731 WP_003419428.1.9986 YP_001087781.1.32744 gi|384360483|ref|YP_006198335.1| gi|126698884|ref|YP_001087781.1| gi|260682894|ref|YP_003214179.1| 272563.CD1287 645462.CD196_1149 645463.CDR20291_1127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]