SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260682906|ref|YP_003214191.1| from Clostridium difficile CD196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260682906|ref|YP_003214191.1|
Domain Number 1 Region: 6-143
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.73e-19
Family MarR-like transcriptional regulators 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|260682906|ref|YP_003214191.1|
Sequence length 146
Comment MarR family transcriptional regulator [Clostridium difficile CD196]
Sequence
MSDKELSILLLESMNNFHNLIKIINNERYKKDKVLTERQFFALVKIRKHDKIELKNLSRD
LHVSTSSLCILLNKLVEQEYVYREEDSRDRRNTFYGITKNGEKILDNEILKFVSIISDKM
DCLDIDNKDKLFTSLEESKNIIEQLF
Download sequence
Identical sequences A0A031WET2 A0A0H3N165 A0A0J0UBL1 A0A125V4E3 A0A1F2CTS4 A0A2I2JSD7 C9YKN7 D5Q5U8 D5S2Q8 G6B7L5 G6BMK3 Q18BG0 T4HRK3 U3UIS0 U3V4G4 U3VJ15
272563.CD1299 645462.CD196_1161 645463.CDR20291_1139 gi|384360495|ref|YP_006198347.1| gi|260686504|ref|YP_003217637.1| WP_003419459.1.100055 WP_003419459.1.100097 WP_003419459.1.100099 WP_003419459.1.100107 WP_003419459.1.100118 WP_003419459.1.100139 WP_003419459.1.100513 WP_003419459.1.100570 WP_003419459.1.100660 WP_003419459.1.100831 WP_003419459.1.100923 WP_003419459.1.100977 WP_003419459.1.101035 WP_003419459.1.101125 WP_003419459.1.101279 WP_003419459.1.10130 WP_003419459.1.101316 WP_003419459.1.101532 WP_003419459.1.101861 WP_003419459.1.101929 WP_003419459.1.102031 WP_003419459.1.102074 WP_003419459.1.102095 WP_003419459.1.10483 WP_003419459.1.10488 WP_003419459.1.10582 WP_003419459.1.10691 WP_003419459.1.10793 WP_003419459.1.10795 WP_003419459.1.11025 WP_003419459.1.11224 WP_003419459.1.11278 WP_003419459.1.11320 WP_003419459.1.11372 WP_003419459.1.11398 WP_003419459.1.1167 WP_003419459.1.1179 WP_003419459.1.11937 WP_003419459.1.11954 WP_003419459.1.11959 WP_003419459.1.12066 WP_003419459.1.12169 WP_003419459.1.12385 WP_003419459.1.1254 WP_003419459.1.12629 WP_003419459.1.12632 WP_003419459.1.12659 WP_003419459.1.1273 WP_003419459.1.12734 WP_003419459.1.12809 WP_003419459.1.12953 WP_003419459.1.13040 WP_003419459.1.13251 WP_003419459.1.13273 WP_003419459.1.13398 WP_003419459.1.13418 WP_003419459.1.13730 WP_003419459.1.13823 WP_003419459.1.13841 WP_003419459.1.14045 WP_003419459.1.141 WP_003419459.1.14170 WP_003419459.1.14177 WP_003419459.1.14205 WP_003419459.1.1422 WP_003419459.1.14259 WP_003419459.1.14330 WP_003419459.1.14352 WP_003419459.1.1445 WP_003419459.1.14457 WP_003419459.1.14483 WP_003419459.1.14579 WP_003419459.1.14674 WP_003419459.1.14686 WP_003419459.1.14698 WP_003419459.1.14848 WP_003419459.1.1494 WP_003419459.1.15083 WP_003419459.1.15192 WP_003419459.1.15205 WP_003419459.1.15310 WP_003419459.1.15435 WP_003419459.1.16012 WP_003419459.1.16135 WP_003419459.1.16185 WP_003419459.1.16190 WP_003419459.1.16520 WP_003419459.1.16728 WP_003419459.1.16897 WP_003419459.1.169 WP_003419459.1.16931 WP_003419459.1.16966 WP_003419459.1.1705 WP_003419459.1.17371 WP_003419459.1.17413 WP_003419459.1.17463 WP_003419459.1.17512 WP_003419459.1.17611 WP_003419459.1.17638 WP_003419459.1.17808 WP_003419459.1.17851 WP_003419459.1.17879 WP_003419459.1.17908 WP_003419459.1.17960 WP_003419459.1.17998 WP_003419459.1.18060 WP_003419459.1.18207 WP_003419459.1.18212 WP_003419459.1.18298 WP_003419459.1.1838 WP_003419459.1.18407 WP_003419459.1.18455 WP_003419459.1.18462 WP_003419459.1.18551 WP_003419459.1.18680 WP_003419459.1.18805 WP_003419459.1.18970 WP_003419459.1.19152 WP_003419459.1.1926 WP_003419459.1.19290 WP_003419459.1.19627 WP_003419459.1.19648 WP_003419459.1.19704 WP_003419459.1.19899 WP_003419459.1.19956 WP_003419459.1.1999 WP_003419459.1.2002 WP_003419459.1.20132 WP_003419459.1.20184 WP_003419459.1.20302 WP_003419459.1.20313 WP_003419459.1.20481 WP_003419459.1.20650 WP_003419459.1.20728 WP_003419459.1.20872 WP_003419459.1.20875 WP_003419459.1.20960 WP_003419459.1.21000 WP_003419459.1.21048 WP_003419459.1.21201 WP_003419459.1.21220 WP_003419459.1.21417 WP_003419459.1.21502 WP_003419459.1.21520 WP_003419459.1.21547 WP_003419459.1.21618 WP_003419459.1.21704 WP_003419459.1.21893 WP_003419459.1.21925 WP_003419459.1.21980 WP_003419459.1.22020 WP_003419459.1.22079 WP_003419459.1.22128 WP_003419459.1.22222 WP_003419459.1.22228 WP_003419459.1.22313 WP_003419459.1.22357 WP_003419459.1.22395 WP_003419459.1.22411 WP_003419459.1.22417 WP_003419459.1.22568 WP_003419459.1.22569 WP_003419459.1.22615 WP_003419459.1.22768 WP_003419459.1.22893 WP_003419459.1.22937 WP_003419459.1.23096 WP_003419459.1.23208 WP_003419459.1.23287 WP_003419459.1.23338 WP_003419459.1.2363 WP_003419459.1.24197 WP_003419459.1.24457 WP_003419459.1.24520 WP_003419459.1.24826 WP_003419459.1.24889 WP_003419459.1.24900 WP_003419459.1.24987 WP_003419459.1.25416 WP_003419459.1.25761 WP_003419459.1.26024 WP_003419459.1.26044 WP_003419459.1.26358 WP_003419459.1.26482 WP_003419459.1.26494 WP_003419459.1.26697 WP_003419459.1.26829 WP_003419459.1.26940 WP_003419459.1.27300 WP_003419459.1.27563 WP_003419459.1.2758 WP_003419459.1.27677 WP_003419459.1.27708 WP_003419459.1.27824 WP_003419459.1.27872 WP_003419459.1.27881 WP_003419459.1.27890 WP_003419459.1.27967 WP_003419459.1.27989 WP_003419459.1.27996 WP_003419459.1.28055 WP_003419459.1.28410 WP_003419459.1.28638 WP_003419459.1.28715 WP_003419459.1.28856 WP_003419459.1.28882 WP_003419459.1.28890 WP_003419459.1.28930 WP_003419459.1.2923 WP_003419459.1.293 WP_003419459.1.29600 WP_003419459.1.29757 WP_003419459.1.2982 WP_003419459.1.29891 WP_003419459.1.29939 WP_003419459.1.3024 WP_003419459.1.303 WP_003419459.1.3031 WP_003419459.1.30420 WP_003419459.1.30431 WP_003419459.1.30463 WP_003419459.1.30519 WP_003419459.1.30521 WP_003419459.1.30743 WP_003419459.1.30841 WP_003419459.1.30953 WP_003419459.1.31160 WP_003419459.1.31183 WP_003419459.1.31203 WP_003419459.1.31292 WP_003419459.1.31351 WP_003419459.1.31385 WP_003419459.1.31453 WP_003419459.1.31475 WP_003419459.1.31477 WP_003419459.1.31519 WP_003419459.1.31637 WP_003419459.1.31719 WP_003419459.1.31742 WP_003419459.1.31960 WP_003419459.1.31969 WP_003419459.1.32008 WP_003419459.1.32066 WP_003419459.1.32119 WP_003419459.1.32166 WP_003419459.1.32197 WP_003419459.1.32218 WP_003419459.1.32230 WP_003419459.1.32294 WP_003419459.1.32699 WP_003419459.1.32769 WP_003419459.1.32776 WP_003419459.1.32842 WP_003419459.1.32953 WP_003419459.1.33056 WP_003419459.1.33098 WP_003419459.1.33164 WP_003419459.1.33275 WP_003419459.1.33298 WP_003419459.1.33332 WP_003419459.1.33349 WP_003419459.1.33514 WP_003419459.1.33810 WP_003419459.1.34388 WP_003419459.1.34489 WP_003419459.1.34545 WP_003419459.1.34641 WP_003419459.1.34989 WP_003419459.1.35 WP_003419459.1.35002 WP_003419459.1.35137 WP_003419459.1.35181 WP_003419459.1.35187 WP_003419459.1.35234 WP_003419459.1.35709 WP_003419459.1.35832 WP_003419459.1.35884 WP_003419459.1.36078 WP_003419459.1.36257 WP_003419459.1.36338 WP_003419459.1.36738 WP_003419459.1.36835 WP_003419459.1.374 WP_003419459.1.37493 WP_003419459.1.37532 WP_003419459.1.37597 WP_003419459.1.37861 WP_003419459.1.3789 WP_003419459.1.37957 WP_003419459.1.37981 WP_003419459.1.38305 WP_003419459.1.38338 WP_003419459.1.38692 WP_003419459.1.38814 WP_003419459.1.38874 WP_003419459.1.38924 WP_003419459.1.38986 WP_003419459.1.39008 WP_003419459.1.3913 WP_003419459.1.39213 WP_003419459.1.39350 WP_003419459.1.39382 WP_003419459.1.39442 WP_003419459.1.39525 WP_003419459.1.39621 WP_003419459.1.39783 WP_003419459.1.39874 WP_003419459.1.39876 WP_003419459.1.39975 WP_003419459.1.39981 WP_003419459.1.40030 WP_003419459.1.40313 WP_003419459.1.40447 WP_003419459.1.40516 WP_003419459.1.40522 WP_003419459.1.40557 WP_003419459.1.407 WP_003419459.1.40775 WP_003419459.1.40891 WP_003419459.1.40959 WP_003419459.1.40966 WP_003419459.1.41131 WP_003419459.1.4121 WP_003419459.1.41334 WP_003419459.1.41342 WP_003419459.1.4137 WP_003419459.1.41506 WP_003419459.1.41534 WP_003419459.1.41641 WP_003419459.1.41687 WP_003419459.1.41818 WP_003419459.1.41995 WP_003419459.1.42035 WP_003419459.1.4204 WP_003419459.1.42066 WP_003419459.1.42532 WP_003419459.1.42610 WP_003419459.1.42664 WP_003419459.1.43112 WP_003419459.1.4315 WP_003419459.1.4321 WP_003419459.1.43388 WP_003419459.1.43490 WP_003419459.1.43519 WP_003419459.1.43579 WP_003419459.1.43663 WP_003419459.1.4383 WP_003419459.1.44030 WP_003419459.1.44105 WP_003419459.1.44149 WP_003419459.1.44198 WP_003419459.1.44470 WP_003419459.1.44471 WP_003419459.1.45017 WP_003419459.1.45059 WP_003419459.1.45142 WP_003419459.1.45165 WP_003419459.1.45209 WP_003419459.1.45257 WP_003419459.1.45352 WP_003419459.1.45554 WP_003419459.1.4573 WP_003419459.1.45938 WP_003419459.1.45986 WP_003419459.1.46066 WP_003419459.1.46117 WP_003419459.1.46274 WP_003419459.1.46280 WP_003419459.1.46305 WP_003419459.1.46522 WP_003419459.1.47016 WP_003419459.1.47121 WP_003419459.1.47173 WP_003419459.1.47227 WP_003419459.1.47479 WP_003419459.1.47615 WP_003419459.1.47708 WP_003419459.1.47729 WP_003419459.1.47940 WP_003419459.1.48220 WP_003419459.1.48246 WP_003419459.1.48279 WP_003419459.1.4835 WP_003419459.1.48491 WP_003419459.1.48733 WP_003419459.1.48746 WP_003419459.1.48772 WP_003419459.1.48935 WP_003419459.1.48980 WP_003419459.1.48983 WP_003419459.1.48991 WP_003419459.1.49020 WP_003419459.1.49054 WP_003419459.1.49065 WP_003419459.1.4908 WP_003419459.1.49230 WP_003419459.1.49310 WP_003419459.1.49339 WP_003419459.1.49451 WP_003419459.1.4948 WP_003419459.1.49633 WP_003419459.1.50159 WP_003419459.1.50341 WP_003419459.1.50460 WP_003419459.1.50495 WP_003419459.1.5073 WP_003419459.1.50865 WP_003419459.1.51007 WP_003419459.1.51166 WP_003419459.1.51675 WP_003419459.1.5187 WP_003419459.1.52073 WP_003419459.1.52164 WP_003419459.1.52266 WP_003419459.1.52278 WP_003419459.1.52294 WP_003419459.1.52311 WP_003419459.1.52330 WP_003419459.1.52383 WP_003419459.1.52402 WP_003419459.1.52466 WP_003419459.1.52525 WP_003419459.1.52789 WP_003419459.1.52958 WP_003419459.1.52997 WP_003419459.1.53008 WP_003419459.1.53044 WP_003419459.1.53055 WP_003419459.1.53288 WP_003419459.1.53704 WP_003419459.1.53710 WP_003419459.1.53729 WP_003419459.1.53987 WP_003419459.1.54058 WP_003419459.1.54153 WP_003419459.1.5423 WP_003419459.1.54262 WP_003419459.1.54350 WP_003419459.1.54586 WP_003419459.1.54593 WP_003419459.1.54692 WP_003419459.1.55055 WP_003419459.1.5521 WP_003419459.1.55391 WP_003419459.1.5558 WP_003419459.1.559 WP_003419459.1.56006 WP_003419459.1.56217 WP_003419459.1.56252 WP_003419459.1.56337 WP_003419459.1.56556 WP_003419459.1.5657 WP_003419459.1.5661 WP_003419459.1.5664 WP_003419459.1.56711 WP_003419459.1.56754 WP_003419459.1.56927 WP_003419459.1.57099 WP_003419459.1.57337 WP_003419459.1.5750 WP_003419459.1.57711 WP_003419459.1.57827 WP_003419459.1.58015 WP_003419459.1.58216 WP_003419459.1.58304 WP_003419459.1.58315 WP_003419459.1.58323 WP_003419459.1.58463 WP_003419459.1.58531 WP_003419459.1.58665 WP_003419459.1.58677 WP_003419459.1.58711 WP_003419459.1.58818 WP_003419459.1.58956 WP_003419459.1.59032 WP_003419459.1.5905 WP_003419459.1.59588 WP_003419459.1.59618 WP_003419459.1.59628 WP_003419459.1.59707 WP_003419459.1.59752 WP_003419459.1.59990 WP_003419459.1.60040 WP_003419459.1.6031 WP_003419459.1.60563 WP_003419459.1.6070 WP_003419459.1.60957 WP_003419459.1.61042 WP_003419459.1.61140 WP_003419459.1.61293 WP_003419459.1.61492 WP_003419459.1.61679 WP_003419459.1.61716 WP_003419459.1.61866 WP_003419459.1.61972 WP_003419459.1.62049 WP_003419459.1.62095 WP_003419459.1.62128 WP_003419459.1.62340 WP_003419459.1.62577 WP_003419459.1.62624 WP_003419459.1.62637 WP_003419459.1.62797 WP_003419459.1.62941 WP_003419459.1.62986 WP_003419459.1.63020 WP_003419459.1.63059 WP_003419459.1.63237 WP_003419459.1.63239 WP_003419459.1.63248 WP_003419459.1.63343 WP_003419459.1.63378 WP_003419459.1.63516 WP_003419459.1.63570 WP_003419459.1.63581 WP_003419459.1.63598 WP_003419459.1.63599 WP_003419459.1.63804 WP_003419459.1.63852 WP_003419459.1.63853 WP_003419459.1.63950 WP_003419459.1.64020 WP_003419459.1.64092 WP_003419459.1.64197 WP_003419459.1.64369 WP_003419459.1.64447 WP_003419459.1.64546 WP_003419459.1.64573 WP_003419459.1.64859 WP_003419459.1.65064 WP_003419459.1.65067 WP_003419459.1.65313 WP_003419459.1.65369 WP_003419459.1.65889 WP_003419459.1.66119 WP_003419459.1.66237 WP_003419459.1.66439 WP_003419459.1.66565 WP_003419459.1.66587 WP_003419459.1.66643 WP_003419459.1.66701 WP_003419459.1.6671 WP_003419459.1.6675 WP_003419459.1.66805 WP_003419459.1.66847 WP_003419459.1.6685 WP_003419459.1.66887 WP_003419459.1.66888 WP_003419459.1.66900 WP_003419459.1.670 WP_003419459.1.67303 WP_003419459.1.6736 WP_003419459.1.67368 WP_003419459.1.67528 WP_003419459.1.67689 WP_003419459.1.67695 WP_003419459.1.67711 WP_003419459.1.6792 WP_003419459.1.67951 WP_003419459.1.68150 WP_003419459.1.68276 WP_003419459.1.68322 WP_003419459.1.68955 WP_003419459.1.6898 WP_003419459.1.69114 WP_003419459.1.692 WP_003419459.1.69220 WP_003419459.1.69333 WP_003419459.1.69495 WP_003419459.1.69708 WP_003419459.1.6994 WP_003419459.1.700 WP_003419459.1.70152 WP_003419459.1.70179 WP_003419459.1.70320 WP_003419459.1.70464 WP_003419459.1.70695 WP_003419459.1.70710 WP_003419459.1.70820 WP_003419459.1.70886 WP_003419459.1.71079 WP_003419459.1.713 WP_003419459.1.71384 WP_003419459.1.71477 WP_003419459.1.7156 WP_003419459.1.71745 WP_003419459.1.7199 WP_003419459.1.72113 WP_003419459.1.72245 WP_003419459.1.72468 WP_003419459.1.72483 WP_003419459.1.72681 WP_003419459.1.72682 WP_003419459.1.72891 WP_003419459.1.72909 WP_003419459.1.72914 WP_003419459.1.73026 WP_003419459.1.73116 WP_003419459.1.7322 WP_003419459.1.73605 WP_003419459.1.73836 WP_003419459.1.73852 WP_003419459.1.73931 WP_003419459.1.74050 WP_003419459.1.74116 WP_003419459.1.74126 WP_003419459.1.74672 WP_003419459.1.74678 WP_003419459.1.74680 WP_003419459.1.74779 WP_003419459.1.74835 WP_003419459.1.74897 WP_003419459.1.75026 WP_003419459.1.751 WP_003419459.1.75210 WP_003419459.1.75226 WP_003419459.1.75287 WP_003419459.1.75454 WP_003419459.1.75638 WP_003419459.1.75659 WP_003419459.1.76207 WP_003419459.1.7650 WP_003419459.1.76550 WP_003419459.1.76603 WP_003419459.1.76664 WP_003419459.1.76687 WP_003419459.1.76793 WP_003419459.1.76813 WP_003419459.1.76882 WP_003419459.1.76924 WP_003419459.1.7696 WP_003419459.1.77092 WP_003419459.1.77102 WP_003419459.1.77473 WP_003419459.1.77509 WP_003419459.1.77544 WP_003419459.1.7755 WP_003419459.1.77639 WP_003419459.1.77782 WP_003419459.1.77842 WP_003419459.1.77942 WP_003419459.1.78123 WP_003419459.1.78579 WP_003419459.1.78949 WP_003419459.1.79125 WP_003419459.1.7916 WP_003419459.1.79199 WP_003419459.1.79221 WP_003419459.1.79344 WP_003419459.1.79437 WP_003419459.1.79673 WP_003419459.1.79680 WP_003419459.1.79703 WP_003419459.1.79836 WP_003419459.1.79956 WP_003419459.1.80052 WP_003419459.1.80144 WP_003419459.1.80379 WP_003419459.1.80455 WP_003419459.1.80504 WP_003419459.1.80610 WP_003419459.1.81035 WP_003419459.1.81044 WP_003419459.1.81208 WP_003419459.1.81299 WP_003419459.1.81402 WP_003419459.1.81777 WP_003419459.1.82002 WP_003419459.1.82084 WP_003419459.1.82150 WP_003419459.1.82169 WP_003419459.1.82335 WP_003419459.1.82635 WP_003419459.1.82701 WP_003419459.1.82920 WP_003419459.1.8314 WP_003419459.1.83148 WP_003419459.1.83175 WP_003419459.1.83255 WP_003419459.1.83287 WP_003419459.1.83288 WP_003419459.1.83318 WP_003419459.1.83348 WP_003419459.1.8336 WP_003419459.1.834 WP_003419459.1.83477 WP_003419459.1.83515 WP_003419459.1.83641 WP_003419459.1.83918 WP_003419459.1.84195 WP_003419459.1.84253 WP_003419459.1.84528 WP_003419459.1.84606 WP_003419459.1.84843 WP_003419459.1.84880 WP_003419459.1.84923 WP_003419459.1.85020 WP_003419459.1.85127 WP_003419459.1.85214 WP_003419459.1.85219 WP_003419459.1.8527 WP_003419459.1.85420 WP_003419459.1.85442 WP_003419459.1.85454 WP_003419459.1.85776 WP_003419459.1.85863 WP_003419459.1.8587 WP_003419459.1.85874 WP_003419459.1.86008 WP_003419459.1.86011 WP_003419459.1.86049 WP_003419459.1.86088 WP_003419459.1.86094 WP_003419459.1.86116 WP_003419459.1.86117 WP_003419459.1.86328 WP_003419459.1.86395 WP_003419459.1.86618 WP_003419459.1.86743 WP_003419459.1.86767 WP_003419459.1.86837 WP_003419459.1.86914 WP_003419459.1.87058 WP_003419459.1.87326 WP_003419459.1.87454 WP_003419459.1.87714 WP_003419459.1.87723 WP_003419459.1.87730 WP_003419459.1.87918 WP_003419459.1.87932 WP_003419459.1.88091 WP_003419459.1.882 WP_003419459.1.88332 WP_003419459.1.88364 WP_003419459.1.88372 WP_003419459.1.88377 WP_003419459.1.88608 WP_003419459.1.88640 WP_003419459.1.88996 WP_003419459.1.89052 WP_003419459.1.89065 WP_003419459.1.89196 WP_003419459.1.89337 WP_003419459.1.89364 WP_003419459.1.89457 WP_003419459.1.89541 WP_003419459.1.89629 WP_003419459.1.89697 WP_003419459.1.8984 WP_003419459.1.90076 WP_003419459.1.90101 WP_003419459.1.90329 WP_003419459.1.9041 WP_003419459.1.90491 WP_003419459.1.90555 WP_003419459.1.90643 WP_003419459.1.9083 WP_003419459.1.90921 WP_003419459.1.90938 WP_003419459.1.90981 WP_003419459.1.90985 WP_003419459.1.91065 WP_003419459.1.91314 WP_003419459.1.91406 WP_003419459.1.91570 WP_003419459.1.91648 WP_003419459.1.92075 WP_003419459.1.92284 WP_003419459.1.92371 WP_003419459.1.92658 WP_003419459.1.92697 WP_003419459.1.92941 WP_003419459.1.93044 WP_003419459.1.93171 WP_003419459.1.93313 WP_003419459.1.93360 WP_003419459.1.93480 WP_003419459.1.93615 WP_003419459.1.93687 WP_003419459.1.93717 WP_003419459.1.93766 WP_003419459.1.93782 WP_003419459.1.93802 WP_003419459.1.93830 WP_003419459.1.9393 WP_003419459.1.93968 WP_003419459.1.94067 WP_003419459.1.94073 WP_003419459.1.94166 WP_003419459.1.94427 WP_003419459.1.94831 WP_003419459.1.94968 WP_003419459.1.95095 WP_003419459.1.95173 WP_003419459.1.9522 WP_003419459.1.95350 WP_003419459.1.95517 WP_003419459.1.9580 WP_003419459.1.95847 WP_003419459.1.95893 WP_003419459.1.96113 WP_003419459.1.9635 WP_003419459.1.96503 WP_003419459.1.96505 WP_003419459.1.9666 WP_003419459.1.96690 WP_003419459.1.96765 WP_003419459.1.97219 WP_003419459.1.97432 WP_003419459.1.97458 WP_003419459.1.97672 WP_003419459.1.97682 WP_003419459.1.97806 WP_003419459.1.98514 WP_003419459.1.98622 WP_003419459.1.98698 WP_003419459.1.98715 WP_003419459.1.98748 WP_003419459.1.98856 WP_003419459.1.98913 WP_003419459.1.98997 WP_003419459.1.99064 WP_003419459.1.99134 WP_003419459.1.99333 WP_003419459.1.99542 WP_003419459.1.99545 WP_003419459.1.99731 WP_003419459.1.9986 YP_001087793.1.32744 gi|126698896|ref|YP_001087793.1| gi|260682906|ref|YP_003214191.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]