SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260682943|ref|YP_003214228.1| from Clostridium difficile CD196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260682943|ref|YP_003214228.1|
Domain Number 1 Region: 23-145
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.43e-23
Family MarR-like transcriptional regulators 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|260682943|ref|YP_003214228.1|
Sequence length 150
Comment MarR family transcriptional regulator [Clostridium difficile CD196]
Sequence
MNYIVKDTISFLVKTFPKIYSSLYLEDLKKFAPDYNVNKTQLRALVFIKNYGVISMTDLC
SKLNIEKGSLTSMVDDLTDKKYVTRKRDLVDRRKYLIDITEEGDKIATDFMDKLSDGLGE
KLSKLTEEDRKKYLEAINTLQYILNKEEFR
Download sequence
Identical sequences A0A031WG40 A0A0H3N2A3 A0A0J0UBG5 A0A125V4L1 A0A1F2CTN9 A0A2I2JSL7 C9YKS4 D5Q5Y6 D5S2M0 Q18BJ8 T4AYI4 T4HWC2 U3ULW3 U3V4M8 U3VGF8
gi|126698934|ref|YP_001087831.1| gi|384360530|ref|YP_006198382.1| WP_003419561.1.100055 WP_003419561.1.100097 WP_003419561.1.100107 WP_003419561.1.100118 WP_003419561.1.100139 WP_003419561.1.100513 WP_003419561.1.100570 WP_003419561.1.100660 WP_003419561.1.100831 WP_003419561.1.100977 WP_003419561.1.101035 WP_003419561.1.101125 WP_003419561.1.101279 WP_003419561.1.10130 WP_003419561.1.101316 WP_003419561.1.101532 WP_003419561.1.101861 WP_003419561.1.102031 WP_003419561.1.102074 WP_003419561.1.102095 WP_003419561.1.10483 WP_003419561.1.10488 WP_003419561.1.10582 WP_003419561.1.10691 WP_003419561.1.10793 WP_003419561.1.10795 WP_003419561.1.11025 WP_003419561.1.11224 WP_003419561.1.11278 WP_003419561.1.11320 WP_003419561.1.11372 WP_003419561.1.11398 WP_003419561.1.1167 WP_003419561.1.1179 WP_003419561.1.11937 WP_003419561.1.11959 WP_003419561.1.12066 WP_003419561.1.12169 WP_003419561.1.12385 WP_003419561.1.1254 WP_003419561.1.12629 WP_003419561.1.12632 WP_003419561.1.12659 WP_003419561.1.1273 WP_003419561.1.12734 WP_003419561.1.12807 WP_003419561.1.12809 WP_003419561.1.13040 WP_003419561.1.13251 WP_003419561.1.13273 WP_003419561.1.13398 WP_003419561.1.13418 WP_003419561.1.13730 WP_003419561.1.13823 WP_003419561.1.13841 WP_003419561.1.13859 WP_003419561.1.14045 WP_003419561.1.141 WP_003419561.1.14170 WP_003419561.1.14177 WP_003419561.1.14205 WP_003419561.1.1422 WP_003419561.1.14259 WP_003419561.1.14330 WP_003419561.1.14352 WP_003419561.1.1445 WP_003419561.1.14457 WP_003419561.1.14483 WP_003419561.1.14579 WP_003419561.1.14674 WP_003419561.1.14686 WP_003419561.1.14698 WP_003419561.1.14848 WP_003419561.1.1494 WP_003419561.1.15083 WP_003419561.1.15097 WP_003419561.1.15192 WP_003419561.1.15205 WP_003419561.1.15310 WP_003419561.1.15435 WP_003419561.1.15908 WP_003419561.1.16012 WP_003419561.1.16135 WP_003419561.1.16185 WP_003419561.1.16376 WP_003419561.1.16520 WP_003419561.1.16728 WP_003419561.1.169 WP_003419561.1.16931 WP_003419561.1.16966 WP_003419561.1.1705 WP_003419561.1.17371 WP_003419561.1.17413 WP_003419561.1.17463 WP_003419561.1.17512 WP_003419561.1.17611 WP_003419561.1.17638 WP_003419561.1.17808 WP_003419561.1.17851 WP_003419561.1.17879 WP_003419561.1.17908 WP_003419561.1.17960 WP_003419561.1.17998 WP_003419561.1.18060 WP_003419561.1.18207 WP_003419561.1.18212 WP_003419561.1.18298 WP_003419561.1.1838 WP_003419561.1.18407 WP_003419561.1.18455 WP_003419561.1.18462 WP_003419561.1.18551 WP_003419561.1.18680 WP_003419561.1.18805 WP_003419561.1.18970 WP_003419561.1.19088 WP_003419561.1.19152 WP_003419561.1.19290 WP_003419561.1.1934 WP_003419561.1.19648 WP_003419561.1.19704 WP_003419561.1.19899 WP_003419561.1.19956 WP_003419561.1.1999 WP_003419561.1.2002 WP_003419561.1.20132 WP_003419561.1.20184 WP_003419561.1.20302 WP_003419561.1.20313 WP_003419561.1.20481 WP_003419561.1.20650 WP_003419561.1.20728 WP_003419561.1.20872 WP_003419561.1.20875 WP_003419561.1.20960 WP_003419561.1.21000 WP_003419561.1.21048 WP_003419561.1.21201 WP_003419561.1.21220 WP_003419561.1.21417 WP_003419561.1.21520 WP_003419561.1.21547 WP_003419561.1.21618 WP_003419561.1.21704 WP_003419561.1.21893 WP_003419561.1.21925 WP_003419561.1.21980 WP_003419561.1.22020 WP_003419561.1.22079 WP_003419561.1.22222 WP_003419561.1.22228 WP_003419561.1.22313 WP_003419561.1.22395 WP_003419561.1.22411 WP_003419561.1.22417 WP_003419561.1.22568 WP_003419561.1.22569 WP_003419561.1.22615 WP_003419561.1.22768 WP_003419561.1.22893 WP_003419561.1.22937 WP_003419561.1.23096 WP_003419561.1.23208 WP_003419561.1.23287 WP_003419561.1.23338 WP_003419561.1.2363 WP_003419561.1.24197 WP_003419561.1.24457 WP_003419561.1.24520 WP_003419561.1.24889 WP_003419561.1.24900 WP_003419561.1.24987 WP_003419561.1.25128 WP_003419561.1.25416 WP_003419561.1.25761 WP_003419561.1.26024 WP_003419561.1.26358 WP_003419561.1.26482 WP_003419561.1.26494 WP_003419561.1.26697 WP_003419561.1.26829 WP_003419561.1.26940 WP_003419561.1.27300 WP_003419561.1.2758 WP_003419561.1.27677 WP_003419561.1.27708 WP_003419561.1.27824 WP_003419561.1.27872 WP_003419561.1.27881 WP_003419561.1.27890 WP_003419561.1.27967 WP_003419561.1.27989 WP_003419561.1.27996 WP_003419561.1.28055 WP_003419561.1.28410 WP_003419561.1.28638 WP_003419561.1.28715 WP_003419561.1.28856 WP_003419561.1.28882 WP_003419561.1.28890 WP_003419561.1.28930 WP_003419561.1.2923 WP_003419561.1.293 WP_003419561.1.29600 WP_003419561.1.29757 WP_003419561.1.2982 WP_003419561.1.29891 WP_003419561.1.29939 WP_003419561.1.3024 WP_003419561.1.303 WP_003419561.1.3031 WP_003419561.1.30420 WP_003419561.1.30431 WP_003419561.1.30463 WP_003419561.1.30519 WP_003419561.1.30521 WP_003419561.1.30743 WP_003419561.1.30841 WP_003419561.1.30953 WP_003419561.1.31160 WP_003419561.1.31183 WP_003419561.1.31203 WP_003419561.1.31292 WP_003419561.1.31309 WP_003419561.1.31351 WP_003419561.1.31385 WP_003419561.1.31453 WP_003419561.1.31475 WP_003419561.1.31477 WP_003419561.1.31519 WP_003419561.1.31637 WP_003419561.1.31719 WP_003419561.1.31742 WP_003419561.1.31960 WP_003419561.1.31969 WP_003419561.1.32008 WP_003419561.1.32066 WP_003419561.1.32119 WP_003419561.1.32166 WP_003419561.1.32197 WP_003419561.1.32218 WP_003419561.1.32230 WP_003419561.1.32294 WP_003419561.1.32699 WP_003419561.1.32769 WP_003419561.1.32776 WP_003419561.1.32842 WP_003419561.1.32953 WP_003419561.1.33056 WP_003419561.1.33098 WP_003419561.1.33164 WP_003419561.1.33275 WP_003419561.1.33298 WP_003419561.1.33332 WP_003419561.1.33349 WP_003419561.1.3340 WP_003419561.1.33514 WP_003419561.1.33810 WP_003419561.1.34388 WP_003419561.1.34489 WP_003419561.1.34545 WP_003419561.1.34641 WP_003419561.1.34800 WP_003419561.1.34985 WP_003419561.1.35 WP_003419561.1.35002 WP_003419561.1.35137 WP_003419561.1.35181 WP_003419561.1.35234 WP_003419561.1.3559 WP_003419561.1.35832 WP_003419561.1.35884 WP_003419561.1.36078 WP_003419561.1.36257 WP_003419561.1.36338 WP_003419561.1.36738 WP_003419561.1.36835 WP_003419561.1.37255 WP_003419561.1.374 WP_003419561.1.37493 WP_003419561.1.37532 WP_003419561.1.37597 WP_003419561.1.37861 WP_003419561.1.3789 WP_003419561.1.37957 WP_003419561.1.37981 WP_003419561.1.38305 WP_003419561.1.38338 WP_003419561.1.38692 WP_003419561.1.38775 WP_003419561.1.38814 WP_003419561.1.38874 WP_003419561.1.38924 WP_003419561.1.38986 WP_003419561.1.39008 WP_003419561.1.3913 WP_003419561.1.39213 WP_003419561.1.39350 WP_003419561.1.39382 WP_003419561.1.39442 WP_003419561.1.39525 WP_003419561.1.39621 WP_003419561.1.39783 WP_003419561.1.39874 WP_003419561.1.39876 WP_003419561.1.39975 WP_003419561.1.39981 WP_003419561.1.40030 WP_003419561.1.40294 WP_003419561.1.40313 WP_003419561.1.40447 WP_003419561.1.40516 WP_003419561.1.40522 WP_003419561.1.40557 WP_003419561.1.407 WP_003419561.1.40775 WP_003419561.1.40891 WP_003419561.1.40959 WP_003419561.1.40966 WP_003419561.1.41131 WP_003419561.1.4121 WP_003419561.1.41342 WP_003419561.1.4137 WP_003419561.1.41506 WP_003419561.1.41534 WP_003419561.1.41641 WP_003419561.1.41687 WP_003419561.1.41818 WP_003419561.1.41995 WP_003419561.1.42035 WP_003419561.1.4204 WP_003419561.1.42066 WP_003419561.1.42532 WP_003419561.1.42533 WP_003419561.1.42610 WP_003419561.1.42664 WP_003419561.1.43112 WP_003419561.1.4315 WP_003419561.1.4321 WP_003419561.1.43388 WP_003419561.1.43490 WP_003419561.1.43519 WP_003419561.1.43579 WP_003419561.1.43663 WP_003419561.1.43824 WP_003419561.1.4383 WP_003419561.1.44030 WP_003419561.1.44105 WP_003419561.1.44198 WP_003419561.1.44241 WP_003419561.1.44470 WP_003419561.1.44471 WP_003419561.1.44729 WP_003419561.1.45017 WP_003419561.1.45059 WP_003419561.1.45142 WP_003419561.1.45165 WP_003419561.1.45209 WP_003419561.1.45257 WP_003419561.1.45352 WP_003419561.1.45554 WP_003419561.1.4573 WP_003419561.1.45938 WP_003419561.1.45986 WP_003419561.1.46066 WP_003419561.1.46117 WP_003419561.1.46274 WP_003419561.1.46280 WP_003419561.1.46305 WP_003419561.1.46522 WP_003419561.1.4698 WP_003419561.1.47016 WP_003419561.1.47121 WP_003419561.1.47227 WP_003419561.1.47228 WP_003419561.1.47479 WP_003419561.1.47615 WP_003419561.1.47708 WP_003419561.1.47729 WP_003419561.1.47940 WP_003419561.1.48246 WP_003419561.1.48279 WP_003419561.1.4835 WP_003419561.1.48491 WP_003419561.1.48746 WP_003419561.1.48772 WP_003419561.1.48935 WP_003419561.1.48980 WP_003419561.1.48983 WP_003419561.1.48991 WP_003419561.1.49020 WP_003419561.1.49054 WP_003419561.1.49065 WP_003419561.1.4908 WP_003419561.1.49092 WP_003419561.1.49230 WP_003419561.1.49310 WP_003419561.1.49339 WP_003419561.1.49451 WP_003419561.1.4948 WP_003419561.1.49633 WP_003419561.1.50159 WP_003419561.1.50341 WP_003419561.1.50495 WP_003419561.1.5073 WP_003419561.1.50865 WP_003419561.1.51007 WP_003419561.1.51166 WP_003419561.1.51235 WP_003419561.1.51675 WP_003419561.1.51996 WP_003419561.1.52073 WP_003419561.1.52164 WP_003419561.1.52266 WP_003419561.1.52278 WP_003419561.1.52311 WP_003419561.1.52330 WP_003419561.1.52383 WP_003419561.1.52402 WP_003419561.1.52466 WP_003419561.1.52525 WP_003419561.1.52789 WP_003419561.1.52958 WP_003419561.1.52997 WP_003419561.1.53008 WP_003419561.1.53044 WP_003419561.1.53055 WP_003419561.1.53288 WP_003419561.1.5337 WP_003419561.1.53504 WP_003419561.1.53704 WP_003419561.1.53710 WP_003419561.1.53729 WP_003419561.1.53987 WP_003419561.1.54058 WP_003419561.1.54153 WP_003419561.1.5423 WP_003419561.1.54262 WP_003419561.1.54350 WP_003419561.1.54586 WP_003419561.1.54692 WP_003419561.1.55055 WP_003419561.1.55101 WP_003419561.1.5521 WP_003419561.1.55302 WP_003419561.1.55371 WP_003419561.1.55391 WP_003419561.1.5558 WP_003419561.1.559 WP_003419561.1.56006 WP_003419561.1.56217 WP_003419561.1.56252 WP_003419561.1.56323 WP_003419561.1.56337 WP_003419561.1.56556 WP_003419561.1.5657 WP_003419561.1.5661 WP_003419561.1.5664 WP_003419561.1.56664 WP_003419561.1.56711 WP_003419561.1.56754 WP_003419561.1.56927 WP_003419561.1.56998 WP_003419561.1.57337 WP_003419561.1.5750 WP_003419561.1.57827 WP_003419561.1.58015 WP_003419561.1.58216 WP_003419561.1.58304 WP_003419561.1.58315 WP_003419561.1.58323 WP_003419561.1.58463 WP_003419561.1.58531 WP_003419561.1.58665 WP_003419561.1.58677 WP_003419561.1.58711 WP_003419561.1.58818 WP_003419561.1.58956 WP_003419561.1.59032 WP_003419561.1.5905 WP_003419561.1.59588 WP_003419561.1.59618 WP_003419561.1.59628 WP_003419561.1.59707 WP_003419561.1.59752 WP_003419561.1.59990 WP_003419561.1.6031 WP_003419561.1.60482 WP_003419561.1.6070 WP_003419561.1.60957 WP_003419561.1.60998 WP_003419561.1.61042 WP_003419561.1.61140 WP_003419561.1.61293 WP_003419561.1.61492 WP_003419561.1.61679 WP_003419561.1.61716 WP_003419561.1.61866 WP_003419561.1.61972 WP_003419561.1.62049 WP_003419561.1.62095 WP_003419561.1.62128 WP_003419561.1.62340 WP_003419561.1.62577 WP_003419561.1.62624 WP_003419561.1.62637 WP_003419561.1.62797 WP_003419561.1.62941 WP_003419561.1.62986 WP_003419561.1.63020 WP_003419561.1.63059 WP_003419561.1.63239 WP_003419561.1.63248 WP_003419561.1.63343 WP_003419561.1.63378 WP_003419561.1.63516 WP_003419561.1.63570 WP_003419561.1.63581 WP_003419561.1.63598 WP_003419561.1.63599 WP_003419561.1.63696 WP_003419561.1.63804 WP_003419561.1.63852 WP_003419561.1.63853 WP_003419561.1.64020 WP_003419561.1.64092 WP_003419561.1.64197 WP_003419561.1.64369 WP_003419561.1.64447 WP_003419561.1.64546 WP_003419561.1.64573 WP_003419561.1.64859 WP_003419561.1.65064 WP_003419561.1.65067 WP_003419561.1.65369 WP_003419561.1.65889 WP_003419561.1.66084 WP_003419561.1.66119 WP_003419561.1.66237 WP_003419561.1.66439 WP_003419561.1.66474 WP_003419561.1.66565 WP_003419561.1.66587 WP_003419561.1.66643 WP_003419561.1.66701 WP_003419561.1.6671 WP_003419561.1.6675 WP_003419561.1.66805 WP_003419561.1.66847 WP_003419561.1.6685 WP_003419561.1.66887 WP_003419561.1.66888 WP_003419561.1.66900 WP_003419561.1.670 WP_003419561.1.67303 WP_003419561.1.67308 WP_003419561.1.6736 WP_003419561.1.67368 WP_003419561.1.67528 WP_003419561.1.67689 WP_003419561.1.67695 WP_003419561.1.67711 WP_003419561.1.6792 WP_003419561.1.67951 WP_003419561.1.68150 WP_003419561.1.68322 WP_003419561.1.68955 WP_003419561.1.6898 WP_003419561.1.68980 WP_003419561.1.69114 WP_003419561.1.692 WP_003419561.1.69220 WP_003419561.1.69333 WP_003419561.1.69495 WP_003419561.1.69708 WP_003419561.1.6994 WP_003419561.1.700 WP_003419561.1.70152 WP_003419561.1.70179 WP_003419561.1.70231 WP_003419561.1.70320 WP_003419561.1.70464 WP_003419561.1.70695 WP_003419561.1.70710 WP_003419561.1.70820 WP_003419561.1.70886 WP_003419561.1.71079 WP_003419561.1.71119 WP_003419561.1.713 WP_003419561.1.71384 WP_003419561.1.71477 WP_003419561.1.7156 WP_003419561.1.71745 WP_003419561.1.7199 WP_003419561.1.72113 WP_003419561.1.72245 WP_003419561.1.72468 WP_003419561.1.72483 WP_003419561.1.72560 WP_003419561.1.72682 WP_003419561.1.72891 WP_003419561.1.72909 WP_003419561.1.72914 WP_003419561.1.72994 WP_003419561.1.73026 WP_003419561.1.73116 WP_003419561.1.7322 WP_003419561.1.73852 WP_003419561.1.73931 WP_003419561.1.74116 WP_003419561.1.74126 WP_003419561.1.74672 WP_003419561.1.74678 WP_003419561.1.74680 WP_003419561.1.74835 WP_003419561.1.74897 WP_003419561.1.75026 WP_003419561.1.751 WP_003419561.1.75210 WP_003419561.1.75226 WP_003419561.1.75287 WP_003419561.1.75454 WP_003419561.1.75638 WP_003419561.1.75659 WP_003419561.1.76207 WP_003419561.1.7650 WP_003419561.1.76550 WP_003419561.1.76552 WP_003419561.1.76603 WP_003419561.1.76621 WP_003419561.1.76664 WP_003419561.1.76687 WP_003419561.1.76793 WP_003419561.1.76813 WP_003419561.1.76882 WP_003419561.1.76924 WP_003419561.1.7696 WP_003419561.1.77092 WP_003419561.1.77102 WP_003419561.1.77473 WP_003419561.1.77509 WP_003419561.1.77544 WP_003419561.1.7755 WP_003419561.1.77639 WP_003419561.1.77782 WP_003419561.1.77842 WP_003419561.1.77942 WP_003419561.1.78123 WP_003419561.1.78579 WP_003419561.1.78949 WP_003419561.1.79125 WP_003419561.1.7916 WP_003419561.1.79199 WP_003419561.1.79221 WP_003419561.1.79309 WP_003419561.1.79344 WP_003419561.1.79437 WP_003419561.1.79611 WP_003419561.1.79673 WP_003419561.1.79680 WP_003419561.1.79703 WP_003419561.1.79836 WP_003419561.1.79956 WP_003419561.1.80052 WP_003419561.1.80144 WP_003419561.1.80342 WP_003419561.1.80379 WP_003419561.1.80455 WP_003419561.1.80575 WP_003419561.1.80610 WP_003419561.1.80963 WP_003419561.1.81035 WP_003419561.1.81044 WP_003419561.1.81208 WP_003419561.1.81299 WP_003419561.1.81351 WP_003419561.1.81402 WP_003419561.1.81605 WP_003419561.1.81777 WP_003419561.1.82084 WP_003419561.1.82169 WP_003419561.1.82335 WP_003419561.1.82635 WP_003419561.1.82701 WP_003419561.1.82920 WP_003419561.1.8314 WP_003419561.1.83148 WP_003419561.1.83175 WP_003419561.1.83255 WP_003419561.1.83287 WP_003419561.1.83288 WP_003419561.1.83318 WP_003419561.1.83348 WP_003419561.1.834 WP_003419561.1.83477 WP_003419561.1.83641 WP_003419561.1.83822 WP_003419561.1.83918 WP_003419561.1.84195 WP_003419561.1.84253 WP_003419561.1.84528 WP_003419561.1.84606 WP_003419561.1.84646 WP_003419561.1.84843 WP_003419561.1.84880 WP_003419561.1.84923 WP_003419561.1.85020 WP_003419561.1.85127 WP_003419561.1.85214 WP_003419561.1.85219 WP_003419561.1.8527 WP_003419561.1.85420 WP_003419561.1.85442 WP_003419561.1.85454 WP_003419561.1.85776 WP_003419561.1.85863 WP_003419561.1.8587 WP_003419561.1.85874 WP_003419561.1.85932 WP_003419561.1.86008 WP_003419561.1.86011 WP_003419561.1.86049 WP_003419561.1.86088 WP_003419561.1.86094 WP_003419561.1.86116 WP_003419561.1.86117 WP_003419561.1.86328 WP_003419561.1.86395 WP_003419561.1.86534 WP_003419561.1.86743 WP_003419561.1.86767 WP_003419561.1.86837 WP_003419561.1.86914 WP_003419561.1.87058 WP_003419561.1.87195 WP_003419561.1.87326 WP_003419561.1.87454 WP_003419561.1.87714 WP_003419561.1.87723 WP_003419561.1.87730 WP_003419561.1.87918 WP_003419561.1.87932 WP_003419561.1.88091 WP_003419561.1.882 WP_003419561.1.88268 WP_003419561.1.88332 WP_003419561.1.88364 WP_003419561.1.88372 WP_003419561.1.88377 WP_003419561.1.88608 WP_003419561.1.88640 WP_003419561.1.88996 WP_003419561.1.89052 WP_003419561.1.89065 WP_003419561.1.89196 WP_003419561.1.89337 WP_003419561.1.89364 WP_003419561.1.89457 WP_003419561.1.89629 WP_003419561.1.89697 WP_003419561.1.89994 WP_003419561.1.90076 WP_003419561.1.90101 WP_003419561.1.90164 WP_003419561.1.90329 WP_003419561.1.9041 WP_003419561.1.90491 WP_003419561.1.90555 WP_003419561.1.90643 WP_003419561.1.9083 WP_003419561.1.90921 WP_003419561.1.90938 WP_003419561.1.90981 WP_003419561.1.91065 WP_003419561.1.91254 WP_003419561.1.91314 WP_003419561.1.91406 WP_003419561.1.91570 WP_003419561.1.91648 WP_003419561.1.92075 WP_003419561.1.92284 WP_003419561.1.92371 WP_003419561.1.92576 WP_003419561.1.92658 WP_003419561.1.92697 WP_003419561.1.92941 WP_003419561.1.93044 WP_003419561.1.93171 WP_003419561.1.93360 WP_003419561.1.93480 WP_003419561.1.93615 WP_003419561.1.93687 WP_003419561.1.93717 WP_003419561.1.93782 WP_003419561.1.93798 WP_003419561.1.93802 WP_003419561.1.93830 WP_003419561.1.9393 WP_003419561.1.94067 WP_003419561.1.94073 WP_003419561.1.94166 WP_003419561.1.94427 WP_003419561.1.94768 WP_003419561.1.94968 WP_003419561.1.95095 WP_003419561.1.95173 WP_003419561.1.9522 WP_003419561.1.95350 WP_003419561.1.95517 WP_003419561.1.9580 WP_003419561.1.95847 WP_003419561.1.95893 WP_003419561.1.96113 WP_003419561.1.9635 WP_003419561.1.96503 WP_003419561.1.96505 WP_003419561.1.9666 WP_003419561.1.96690 WP_003419561.1.96765 WP_003419561.1.97219 WP_003419561.1.97432 WP_003419561.1.97458 WP_003419561.1.97672 WP_003419561.1.97682 WP_003419561.1.97806 WP_003419561.1.98037 WP_003419561.1.98514 WP_003419561.1.98622 WP_003419561.1.98698 WP_003419561.1.98715 WP_003419561.1.98856 WP_003419561.1.98997 WP_003419561.1.99064 WP_003419561.1.99134 WP_003419561.1.99333 WP_003419561.1.99542 WP_003419561.1.99545 WP_003419561.1.99731 WP_003419561.1.9986 YP_001087831.1.32744 gi|260686541|ref|YP_003217674.1| 272563.CD1335 645462.CD196_1198 645463.CDR20291_1176 gi|260682943|ref|YP_003214228.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]