SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260682954|ref|YP_003214239.1| from Clostridium difficile CD196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260682954|ref|YP_003214239.1|
Domain Number 1 Region: 10-97
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.07e-23
Family PadR-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|260682954|ref|YP_003214239.1|
Sequence length 110
Comment padr family transcriptional regulator [Clostridium difficile CD196]
Sequence
MNTQFRKGVLEICVLALISKKDMYGYEIVHNISKVIDVNEGTIYPILRRLTKDLYFETYI
LESNEGPARKYYRITSLGKENLSNLMEEWREFVKAVEILISEDEGGNELE
Download sequence
Identical sequences A0A031WFH0 A0A0H3N1B8 A0A0J0UBG1 A0A125V4M8 A0A1F2CTN4 C9YKT5 Q18BK8 T3DDY5 T4ASA0 T4HY63
WP_009889116.1.100055 WP_009889116.1.100097 WP_009889116.1.100099 WP_009889116.1.100107 WP_009889116.1.100118 WP_009889116.1.100139 WP_009889116.1.100513 WP_009889116.1.100570 WP_009889116.1.100660 WP_009889116.1.100831 WP_009889116.1.100923 WP_009889116.1.100977 WP_009889116.1.101035 WP_009889116.1.101125 WP_009889116.1.101279 WP_009889116.1.10130 WP_009889116.1.101316 WP_009889116.1.101532 WP_009889116.1.101861 WP_009889116.1.101929 WP_009889116.1.102031 WP_009889116.1.102074 WP_009889116.1.102095 WP_009889116.1.10483 WP_009889116.1.10488 WP_009889116.1.10582 WP_009889116.1.10691 WP_009889116.1.10793 WP_009889116.1.10795 WP_009889116.1.11025 WP_009889116.1.11134 WP_009889116.1.11224 WP_009889116.1.11278 WP_009889116.1.11320 WP_009889116.1.11398 WP_009889116.1.1167 WP_009889116.1.1179 WP_009889116.1.11937 WP_009889116.1.11954 WP_009889116.1.11959 WP_009889116.1.12066 WP_009889116.1.12169 WP_009889116.1.12385 WP_009889116.1.1254 WP_009889116.1.12629 WP_009889116.1.12632 WP_009889116.1.12659 WP_009889116.1.1273 WP_009889116.1.12734 WP_009889116.1.12807 WP_009889116.1.12809 WP_009889116.1.12953 WP_009889116.1.13040 WP_009889116.1.13251 WP_009889116.1.13273 WP_009889116.1.13398 WP_009889116.1.13418 WP_009889116.1.13730 WP_009889116.1.13841 WP_009889116.1.13859 WP_009889116.1.14045 WP_009889116.1.141 WP_009889116.1.14170 WP_009889116.1.14177 WP_009889116.1.14205 WP_009889116.1.1422 WP_009889116.1.14259 WP_009889116.1.14330 WP_009889116.1.14352 WP_009889116.1.1445 WP_009889116.1.14457 WP_009889116.1.14483 WP_009889116.1.14579 WP_009889116.1.14674 WP_009889116.1.14686 WP_009889116.1.14698 WP_009889116.1.14848 WP_009889116.1.1494 WP_009889116.1.15083 WP_009889116.1.15097 WP_009889116.1.15192 WP_009889116.1.15205 WP_009889116.1.15310 WP_009889116.1.15435 WP_009889116.1.15908 WP_009889116.1.16012 WP_009889116.1.16135 WP_009889116.1.16185 WP_009889116.1.16190 WP_009889116.1.16376 WP_009889116.1.16520 WP_009889116.1.16728 WP_009889116.1.16897 WP_009889116.1.169 WP_009889116.1.16931 WP_009889116.1.16966 WP_009889116.1.1705 WP_009889116.1.17371 WP_009889116.1.17413 WP_009889116.1.17463 WP_009889116.1.17512 WP_009889116.1.17611 WP_009889116.1.17638 WP_009889116.1.17808 WP_009889116.1.17851 WP_009889116.1.17879 WP_009889116.1.17908 WP_009889116.1.17960 WP_009889116.1.18060 WP_009889116.1.18207 WP_009889116.1.18212 WP_009889116.1.18298 WP_009889116.1.1838 WP_009889116.1.18407 WP_009889116.1.18455 WP_009889116.1.18462 WP_009889116.1.18551 WP_009889116.1.18680 WP_009889116.1.18805 WP_009889116.1.18970 WP_009889116.1.19088 WP_009889116.1.19152 WP_009889116.1.1926 WP_009889116.1.19290 WP_009889116.1.1934 WP_009889116.1.19627 WP_009889116.1.19648 WP_009889116.1.19704 WP_009889116.1.19899 WP_009889116.1.19956 WP_009889116.1.1999 WP_009889116.1.2002 WP_009889116.1.20132 WP_009889116.1.20184 WP_009889116.1.20302 WP_009889116.1.20313 WP_009889116.1.20481 WP_009889116.1.20650 WP_009889116.1.20728 WP_009889116.1.20872 WP_009889116.1.20875 WP_009889116.1.20960 WP_009889116.1.21000 WP_009889116.1.21048 WP_009889116.1.21201 WP_009889116.1.21220 WP_009889116.1.21417 WP_009889116.1.21502 WP_009889116.1.21520 WP_009889116.1.21547 WP_009889116.1.21618 WP_009889116.1.21704 WP_009889116.1.21893 WP_009889116.1.22020 WP_009889116.1.22079 WP_009889116.1.22128 WP_009889116.1.22222 WP_009889116.1.22228 WP_009889116.1.22313 WP_009889116.1.22357 WP_009889116.1.22411 WP_009889116.1.22417 WP_009889116.1.22568 WP_009889116.1.22569 WP_009889116.1.22615 WP_009889116.1.22768 WP_009889116.1.22893 WP_009889116.1.22937 WP_009889116.1.23096 WP_009889116.1.23208 WP_009889116.1.23287 WP_009889116.1.23338 WP_009889116.1.2363 WP_009889116.1.24197 WP_009889116.1.24457 WP_009889116.1.24520 WP_009889116.1.24826 WP_009889116.1.24889 WP_009889116.1.24900 WP_009889116.1.24987 WP_009889116.1.25128 WP_009889116.1.25416 WP_009889116.1.25761 WP_009889116.1.26024 WP_009889116.1.26044 WP_009889116.1.26358 WP_009889116.1.26482 WP_009889116.1.26494 WP_009889116.1.26697 WP_009889116.1.26829 WP_009889116.1.26940 WP_009889116.1.27563 WP_009889116.1.2758 WP_009889116.1.27677 WP_009889116.1.27708 WP_009889116.1.27824 WP_009889116.1.27872 WP_009889116.1.27881 WP_009889116.1.27890 WP_009889116.1.27967 WP_009889116.1.27989 WP_009889116.1.27996 WP_009889116.1.28055 WP_009889116.1.28410 WP_009889116.1.28638 WP_009889116.1.28715 WP_009889116.1.28856 WP_009889116.1.28882 WP_009889116.1.28890 WP_009889116.1.28930 WP_009889116.1.2923 WP_009889116.1.293 WP_009889116.1.29600 WP_009889116.1.29757 WP_009889116.1.2982 WP_009889116.1.29891 WP_009889116.1.3014 WP_009889116.1.3024 WP_009889116.1.303 WP_009889116.1.3031 WP_009889116.1.30420 WP_009889116.1.30431 WP_009889116.1.30463 WP_009889116.1.30519 WP_009889116.1.30521 WP_009889116.1.30743 WP_009889116.1.30841 WP_009889116.1.30953 WP_009889116.1.31160 WP_009889116.1.31183 WP_009889116.1.31203 WP_009889116.1.31292 WP_009889116.1.31309 WP_009889116.1.31351 WP_009889116.1.31385 WP_009889116.1.31453 WP_009889116.1.31475 WP_009889116.1.31477 WP_009889116.1.31519 WP_009889116.1.31637 WP_009889116.1.31719 WP_009889116.1.31742 WP_009889116.1.31960 WP_009889116.1.31969 WP_009889116.1.32008 WP_009889116.1.32066 WP_009889116.1.32119 WP_009889116.1.32166 WP_009889116.1.32197 WP_009889116.1.32218 WP_009889116.1.32230 WP_009889116.1.32294 WP_009889116.1.32699 WP_009889116.1.32769 WP_009889116.1.32776 WP_009889116.1.32842 WP_009889116.1.33056 WP_009889116.1.33098 WP_009889116.1.33164 WP_009889116.1.33298 WP_009889116.1.33332 WP_009889116.1.33349 WP_009889116.1.3340 WP_009889116.1.33514 WP_009889116.1.33810 WP_009889116.1.34388 WP_009889116.1.34489 WP_009889116.1.34545 WP_009889116.1.34641 WP_009889116.1.34800 WP_009889116.1.34985 WP_009889116.1.34989 WP_009889116.1.35 WP_009889116.1.35002 WP_009889116.1.35137 WP_009889116.1.35181 WP_009889116.1.35187 WP_009889116.1.35234 WP_009889116.1.3559 WP_009889116.1.35709 WP_009889116.1.35832 WP_009889116.1.35884 WP_009889116.1.36078 WP_009889116.1.36257 WP_009889116.1.36338 WP_009889116.1.36738 WP_009889116.1.36835 WP_009889116.1.37255 WP_009889116.1.374 WP_009889116.1.37493 WP_009889116.1.37532 WP_009889116.1.37597 WP_009889116.1.37861 WP_009889116.1.3789 WP_009889116.1.37957 WP_009889116.1.37981 WP_009889116.1.38305 WP_009889116.1.38338 WP_009889116.1.38692 WP_009889116.1.38775 WP_009889116.1.38814 WP_009889116.1.38874 WP_009889116.1.38924 WP_009889116.1.38986 WP_009889116.1.39008 WP_009889116.1.3913 WP_009889116.1.39213 WP_009889116.1.39350 WP_009889116.1.39382 WP_009889116.1.39442 WP_009889116.1.39525 WP_009889116.1.39621 WP_009889116.1.39783 WP_009889116.1.39874 WP_009889116.1.39876 WP_009889116.1.39975 WP_009889116.1.39981 WP_009889116.1.40030 WP_009889116.1.40294 WP_009889116.1.40313 WP_009889116.1.40447 WP_009889116.1.40522 WP_009889116.1.40557 WP_009889116.1.407 WP_009889116.1.40775 WP_009889116.1.40891 WP_009889116.1.40959 WP_009889116.1.40966 WP_009889116.1.41131 WP_009889116.1.4121 WP_009889116.1.41334 WP_009889116.1.41342 WP_009889116.1.4137 WP_009889116.1.41506 WP_009889116.1.41534 WP_009889116.1.41641 WP_009889116.1.41687 WP_009889116.1.41818 WP_009889116.1.41995 WP_009889116.1.42035 WP_009889116.1.4204 WP_009889116.1.42066 WP_009889116.1.42532 WP_009889116.1.42533 WP_009889116.1.42610 WP_009889116.1.42664 WP_009889116.1.43112 WP_009889116.1.4315 WP_009889116.1.4321 WP_009889116.1.43388 WP_009889116.1.43490 WP_009889116.1.43519 WP_009889116.1.43579 WP_009889116.1.43663 WP_009889116.1.43824 WP_009889116.1.4383 WP_009889116.1.44030 WP_009889116.1.44105 WP_009889116.1.44149 WP_009889116.1.44198 WP_009889116.1.44241 WP_009889116.1.44470 WP_009889116.1.44471 WP_009889116.1.44729 WP_009889116.1.45017 WP_009889116.1.45059 WP_009889116.1.45142 WP_009889116.1.45165 WP_009889116.1.45209 WP_009889116.1.45257 WP_009889116.1.45352 WP_009889116.1.45554 WP_009889116.1.4573 WP_009889116.1.45938 WP_009889116.1.45986 WP_009889116.1.46066 WP_009889116.1.46274 WP_009889116.1.46280 WP_009889116.1.46305 WP_009889116.1.46522 WP_009889116.1.4698 WP_009889116.1.47016 WP_009889116.1.47121 WP_009889116.1.47173 WP_009889116.1.47227 WP_009889116.1.47228 WP_009889116.1.47479 WP_009889116.1.47615 WP_009889116.1.47708 WP_009889116.1.47729 WP_009889116.1.47940 WP_009889116.1.48220 WP_009889116.1.48246 WP_009889116.1.48279 WP_009889116.1.4835 WP_009889116.1.48733 WP_009889116.1.48746 WP_009889116.1.48772 WP_009889116.1.48935 WP_009889116.1.48980 WP_009889116.1.48983 WP_009889116.1.48991 WP_009889116.1.49020 WP_009889116.1.49054 WP_009889116.1.49065 WP_009889116.1.4908 WP_009889116.1.49092 WP_009889116.1.49230 WP_009889116.1.49310 WP_009889116.1.49339 WP_009889116.1.4948 WP_009889116.1.49633 WP_009889116.1.50159 WP_009889116.1.50341 WP_009889116.1.50460 WP_009889116.1.5073 WP_009889116.1.50865 WP_009889116.1.51007 WP_009889116.1.51235 WP_009889116.1.51675 WP_009889116.1.5187 WP_009889116.1.51996 WP_009889116.1.52073 WP_009889116.1.52132 WP_009889116.1.52266 WP_009889116.1.52278 WP_009889116.1.52294 WP_009889116.1.52311 WP_009889116.1.52330 WP_009889116.1.52383 WP_009889116.1.52402 WP_009889116.1.52466 WP_009889116.1.52525 WP_009889116.1.52789 WP_009889116.1.52958 WP_009889116.1.52997 WP_009889116.1.53008 WP_009889116.1.53044 WP_009889116.1.53055 WP_009889116.1.5337 WP_009889116.1.53504 WP_009889116.1.53704 WP_009889116.1.53710 WP_009889116.1.53729 WP_009889116.1.53987 WP_009889116.1.54058 WP_009889116.1.54153 WP_009889116.1.5423 WP_009889116.1.54262 WP_009889116.1.54350 WP_009889116.1.54586 WP_009889116.1.54593 WP_009889116.1.54692 WP_009889116.1.55055 WP_009889116.1.55101 WP_009889116.1.5521 WP_009889116.1.55302 WP_009889116.1.55371 WP_009889116.1.55391 WP_009889116.1.5558 WP_009889116.1.559 WP_009889116.1.56006 WP_009889116.1.56217 WP_009889116.1.56252 WP_009889116.1.56323 WP_009889116.1.56337 WP_009889116.1.56556 WP_009889116.1.5657 WP_009889116.1.5661 WP_009889116.1.5664 WP_009889116.1.56664 WP_009889116.1.56711 WP_009889116.1.56754 WP_009889116.1.56927 WP_009889116.1.56998 WP_009889116.1.57099 WP_009889116.1.57337 WP_009889116.1.5750 WP_009889116.1.57711 WP_009889116.1.57827 WP_009889116.1.58015 WP_009889116.1.58216 WP_009889116.1.58304 WP_009889116.1.58315 WP_009889116.1.58323 WP_009889116.1.58463 WP_009889116.1.58531 WP_009889116.1.58665 WP_009889116.1.58677 WP_009889116.1.58711 WP_009889116.1.58818 WP_009889116.1.58956 WP_009889116.1.59032 WP_009889116.1.5905 WP_009889116.1.59588 WP_009889116.1.59618 WP_009889116.1.59628 WP_009889116.1.59707 WP_009889116.1.59752 WP_009889116.1.59990 WP_009889116.1.60040 WP_009889116.1.6031 WP_009889116.1.60482 WP_009889116.1.60563 WP_009889116.1.6070 WP_009889116.1.60957 WP_009889116.1.60998 WP_009889116.1.61042 WP_009889116.1.61140 WP_009889116.1.61293 WP_009889116.1.61492 WP_009889116.1.61679 WP_009889116.1.61716 WP_009889116.1.61866 WP_009889116.1.61972 WP_009889116.1.62049 WP_009889116.1.62095 WP_009889116.1.62128 WP_009889116.1.62340 WP_009889116.1.62577 WP_009889116.1.62624 WP_009889116.1.62637 WP_009889116.1.62941 WP_009889116.1.62986 WP_009889116.1.63020 WP_009889116.1.63059 WP_009889116.1.63237 WP_009889116.1.63239 WP_009889116.1.63248 WP_009889116.1.63343 WP_009889116.1.63378 WP_009889116.1.63516 WP_009889116.1.63570 WP_009889116.1.63581 WP_009889116.1.63598 WP_009889116.1.63599 WP_009889116.1.63696 WP_009889116.1.63804 WP_009889116.1.63853 WP_009889116.1.63950 WP_009889116.1.64020 WP_009889116.1.64092 WP_009889116.1.64197 WP_009889116.1.64369 WP_009889116.1.64447 WP_009889116.1.64546 WP_009889116.1.64573 WP_009889116.1.64859 WP_009889116.1.65064 WP_009889116.1.65067 WP_009889116.1.65313 WP_009889116.1.65369 WP_009889116.1.65889 WP_009889116.1.66084 WP_009889116.1.66119 WP_009889116.1.66237 WP_009889116.1.66439 WP_009889116.1.66474 WP_009889116.1.66565 WP_009889116.1.66587 WP_009889116.1.66608 WP_009889116.1.66643 WP_009889116.1.66701 WP_009889116.1.6671 WP_009889116.1.6675 WP_009889116.1.66805 WP_009889116.1.66847 WP_009889116.1.6685 WP_009889116.1.66887 WP_009889116.1.66888 WP_009889116.1.66900 WP_009889116.1.670 WP_009889116.1.67303 WP_009889116.1.67308 WP_009889116.1.6736 WP_009889116.1.67368 WP_009889116.1.67528 WP_009889116.1.67689 WP_009889116.1.67695 WP_009889116.1.67711 WP_009889116.1.6792 WP_009889116.1.67951 WP_009889116.1.68150 WP_009889116.1.68276 WP_009889116.1.68322 WP_009889116.1.68955 WP_009889116.1.6898 WP_009889116.1.68980 WP_009889116.1.69114 WP_009889116.1.692 WP_009889116.1.69220 WP_009889116.1.69333 WP_009889116.1.69495 WP_009889116.1.69708 WP_009889116.1.6994 WP_009889116.1.700 WP_009889116.1.70152 WP_009889116.1.70179 WP_009889116.1.70231 WP_009889116.1.70320 WP_009889116.1.70695 WP_009889116.1.70710 WP_009889116.1.70820 WP_009889116.1.70886 WP_009889116.1.71079 WP_009889116.1.71119 WP_009889116.1.713 WP_009889116.1.71384 WP_009889116.1.71477 WP_009889116.1.7156 WP_009889116.1.71745 WP_009889116.1.7199 WP_009889116.1.72113 WP_009889116.1.72245 WP_009889116.1.72468 WP_009889116.1.72483 WP_009889116.1.72560 WP_009889116.1.72681 WP_009889116.1.72682 WP_009889116.1.72891 WP_009889116.1.72909 WP_009889116.1.72914 WP_009889116.1.72994 WP_009889116.1.73026 WP_009889116.1.73116 WP_009889116.1.7322 WP_009889116.1.73605 WP_009889116.1.73836 WP_009889116.1.73852 WP_009889116.1.73931 WP_009889116.1.74050 WP_009889116.1.74116 WP_009889116.1.74126 WP_009889116.1.74672 WP_009889116.1.74678 WP_009889116.1.74680 WP_009889116.1.74779 WP_009889116.1.74835 WP_009889116.1.74897 WP_009889116.1.75026 WP_009889116.1.751 WP_009889116.1.75210 WP_009889116.1.75226 WP_009889116.1.75287 WP_009889116.1.75454 WP_009889116.1.75638 WP_009889116.1.75659 WP_009889116.1.76072 WP_009889116.1.76207 WP_009889116.1.7650 WP_009889116.1.76550 WP_009889116.1.76552 WP_009889116.1.76603 WP_009889116.1.76621 WP_009889116.1.76664 WP_009889116.1.76687 WP_009889116.1.76793 WP_009889116.1.76813 WP_009889116.1.76882 WP_009889116.1.76924 WP_009889116.1.7696 WP_009889116.1.77092 WP_009889116.1.77102 WP_009889116.1.77473 WP_009889116.1.77509 WP_009889116.1.77544 WP_009889116.1.7755 WP_009889116.1.77639 WP_009889116.1.77782 WP_009889116.1.77842 WP_009889116.1.77942 WP_009889116.1.78123 WP_009889116.1.78579 WP_009889116.1.78949 WP_009889116.1.79123 WP_009889116.1.7916 WP_009889116.1.79199 WP_009889116.1.79221 WP_009889116.1.79309 WP_009889116.1.79344 WP_009889116.1.79437 WP_009889116.1.79611 WP_009889116.1.79680 WP_009889116.1.79703 WP_009889116.1.79836 WP_009889116.1.79956 WP_009889116.1.80052 WP_009889116.1.80144 WP_009889116.1.80342 WP_009889116.1.80379 WP_009889116.1.80455 WP_009889116.1.80504 WP_009889116.1.80575 WP_009889116.1.80963 WP_009889116.1.81035 WP_009889116.1.81044 WP_009889116.1.81208 WP_009889116.1.81299 WP_009889116.1.81351 WP_009889116.1.81402 WP_009889116.1.81605 WP_009889116.1.81777 WP_009889116.1.82002 WP_009889116.1.82084 WP_009889116.1.82150 WP_009889116.1.82169 WP_009889116.1.82335 WP_009889116.1.82635 WP_009889116.1.82701 WP_009889116.1.82920 WP_009889116.1.8314 WP_009889116.1.83148 WP_009889116.1.83175 WP_009889116.1.83255 WP_009889116.1.83287 WP_009889116.1.83288 WP_009889116.1.83318 WP_009889116.1.83348 WP_009889116.1.8336 WP_009889116.1.834 WP_009889116.1.83477 WP_009889116.1.83515 WP_009889116.1.83822 WP_009889116.1.83918 WP_009889116.1.84253 WP_009889116.1.84528 WP_009889116.1.84646 WP_009889116.1.84843 WP_009889116.1.84880 WP_009889116.1.84923 WP_009889116.1.85020 WP_009889116.1.85127 WP_009889116.1.85214 WP_009889116.1.85219 WP_009889116.1.8527 WP_009889116.1.85420 WP_009889116.1.85442 WP_009889116.1.85454 WP_009889116.1.85776 WP_009889116.1.85863 WP_009889116.1.8587 WP_009889116.1.85874 WP_009889116.1.85932 WP_009889116.1.86008 WP_009889116.1.86011 WP_009889116.1.86049 WP_009889116.1.86088 WP_009889116.1.86094 WP_009889116.1.86116 WP_009889116.1.86117 WP_009889116.1.86328 WP_009889116.1.86395 WP_009889116.1.86534 WP_009889116.1.86618 WP_009889116.1.86743 WP_009889116.1.86767 WP_009889116.1.86837 WP_009889116.1.86914 WP_009889116.1.87058 WP_009889116.1.87195 WP_009889116.1.87326 WP_009889116.1.87454 WP_009889116.1.87714 WP_009889116.1.87723 WP_009889116.1.87730 WP_009889116.1.87918 WP_009889116.1.87932 WP_009889116.1.88091 WP_009889116.1.882 WP_009889116.1.88268 WP_009889116.1.88332 WP_009889116.1.88364 WP_009889116.1.88372 WP_009889116.1.88377 WP_009889116.1.88608 WP_009889116.1.88640 WP_009889116.1.88996 WP_009889116.1.89052 WP_009889116.1.89065 WP_009889116.1.89196 WP_009889116.1.89337 WP_009889116.1.89364 WP_009889116.1.89457 WP_009889116.1.89541 WP_009889116.1.89629 WP_009889116.1.89697 WP_009889116.1.8984 WP_009889116.1.89994 WP_009889116.1.90076 WP_009889116.1.90101 WP_009889116.1.90164 WP_009889116.1.90329 WP_009889116.1.9041 WP_009889116.1.90491 WP_009889116.1.90555 WP_009889116.1.90643 WP_009889116.1.9083 WP_009889116.1.90921 WP_009889116.1.90938 WP_009889116.1.90981 WP_009889116.1.90985 WP_009889116.1.91065 WP_009889116.1.91254 WP_009889116.1.91314 WP_009889116.1.91406 WP_009889116.1.91570 WP_009889116.1.91648 WP_009889116.1.92075 WP_009889116.1.92284 WP_009889116.1.92371 WP_009889116.1.92576 WP_009889116.1.92658 WP_009889116.1.92697 WP_009889116.1.92941 WP_009889116.1.93044 WP_009889116.1.93171 WP_009889116.1.93313 WP_009889116.1.93360 WP_009889116.1.93480 WP_009889116.1.93615 WP_009889116.1.93687 WP_009889116.1.93717 WP_009889116.1.93766 WP_009889116.1.93782 WP_009889116.1.93798 WP_009889116.1.93802 WP_009889116.1.93830 WP_009889116.1.9393 WP_009889116.1.93968 WP_009889116.1.94067 WP_009889116.1.94073 WP_009889116.1.94166 WP_009889116.1.94427 WP_009889116.1.94768 WP_009889116.1.94831 WP_009889116.1.94968 WP_009889116.1.95095 WP_009889116.1.95173 WP_009889116.1.9522 WP_009889116.1.95350 WP_009889116.1.95517 WP_009889116.1.9580 WP_009889116.1.95847 WP_009889116.1.95893 WP_009889116.1.96113 WP_009889116.1.9635 WP_009889116.1.96503 WP_009889116.1.96505 WP_009889116.1.9666 WP_009889116.1.96690 WP_009889116.1.96765 WP_009889116.1.97219 WP_009889116.1.97458 WP_009889116.1.97672 WP_009889116.1.97682 WP_009889116.1.97806 WP_009889116.1.98037 WP_009889116.1.98514 WP_009889116.1.98622 WP_009889116.1.98698 WP_009889116.1.98715 WP_009889116.1.98748 WP_009889116.1.98856 WP_009889116.1.98913 WP_009889116.1.98997 WP_009889116.1.99064 WP_009889116.1.99134 WP_009889116.1.99333 WP_009889116.1.99542 WP_009889116.1.99545 WP_009889116.1.99731 WP_009889116.1.9986 YP_001087841.1.32744 272563.CD1345 645462.CD196_1209 645463.CDR20291_1187 gi|384360540|ref|YP_006198392.1| gi|260686552|ref|YP_003217685.1| gi|260682954|ref|YP_003214239.1| gi|126698944|ref|YP_001087841.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]