SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260683041|ref|YP_003214326.1| from Clostridium difficile CD196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260683041|ref|YP_003214326.1|
Domain Number 1 Region: 6-111
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.78e-25
Family HxlR-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|260683041|ref|YP_003214326.1|
Sequence length 121
Comment transcriptional regulator [Clostridium difficile CD196]
Sequence
MKIRAEYTCPLEIVHDIIKGKWKTILIFELRQSNKTFSELQHNIYGINQKMLIQQLKELR
DFGIIDKISSAGYPLHVEYFLTNRGKKMLKAVEIMQEIGIEYMLEHGQQEILDNKGICYN
K
Download sequence
Identical sequences A0A031WF44 A0A0H3N1K1 A0A0J0UB53 A0A125V4R8 A0A1F2DAD0 C9YL22 G6B9T6 G6BFT3 Q18BU7 T4AV36 T4HUP6
gi|260683041|ref|YP_003214326.1| gi|126699031|ref|YP_001087928.1| gi|260686639|ref|YP_003217772.1| WP_003429379.1.100055 WP_003429379.1.100097 WP_003429379.1.100099 WP_003429379.1.100139 WP_003429379.1.100513 WP_003429379.1.100660 WP_003429379.1.100831 WP_003429379.1.100977 WP_003429379.1.101035 WP_003429379.1.101125 WP_003429379.1.101279 WP_003429379.1.10130 WP_003429379.1.101532 WP_003429379.1.101861 WP_003429379.1.101929 WP_003429379.1.102031 WP_003429379.1.102074 WP_003429379.1.10483 WP_003429379.1.10488 WP_003429379.1.10582 WP_003429379.1.10793 WP_003429379.1.11025 WP_003429379.1.11224 WP_003429379.1.11278 WP_003429379.1.11320 WP_003429379.1.11398 WP_003429379.1.1179 WP_003429379.1.11937 WP_003429379.1.11959 WP_003429379.1.12169 WP_003429379.1.12385 WP_003429379.1.12629 WP_003429379.1.12632 WP_003429379.1.1273 WP_003429379.1.12734 WP_003429379.1.12807 WP_003429379.1.12809 WP_003429379.1.13040 WP_003429379.1.13251 WP_003429379.1.13273 WP_003429379.1.13398 WP_003429379.1.13418 WP_003429379.1.13730 WP_003429379.1.13859 WP_003429379.1.14045 WP_003429379.1.141 WP_003429379.1.14170 WP_003429379.1.14177 WP_003429379.1.14205 WP_003429379.1.1422 WP_003429379.1.14259 WP_003429379.1.14330 WP_003429379.1.1445 WP_003429379.1.14457 WP_003429379.1.14483 WP_003429379.1.14674 WP_003429379.1.14686 WP_003429379.1.14848 WP_003429379.1.15097 WP_003429379.1.15192 WP_003429379.1.15205 WP_003429379.1.15310 WP_003429379.1.15435 WP_003429379.1.15908 WP_003429379.1.16012 WP_003429379.1.16135 WP_003429379.1.16185 WP_003429379.1.16376 WP_003429379.1.16520 WP_003429379.1.16728 WP_003429379.1.16897 WP_003429379.1.16931 WP_003429379.1.16966 WP_003429379.1.1705 WP_003429379.1.17413 WP_003429379.1.17463 WP_003429379.1.17611 WP_003429379.1.17638 WP_003429379.1.17808 WP_003429379.1.17851 WP_003429379.1.17879 WP_003429379.1.17908 WP_003429379.1.18207 WP_003429379.1.18212 WP_003429379.1.18298 WP_003429379.1.1838 WP_003429379.1.18407 WP_003429379.1.18455 WP_003429379.1.18462 WP_003429379.1.18680 WP_003429379.1.18805 WP_003429379.1.18970 WP_003429379.1.19088 WP_003429379.1.19152 WP_003429379.1.19290 WP_003429379.1.1934 WP_003429379.1.19648 WP_003429379.1.19704 WP_003429379.1.19899 WP_003429379.1.1999 WP_003429379.1.20132 WP_003429379.1.20302 WP_003429379.1.20481 WP_003429379.1.20650 WP_003429379.1.20728 WP_003429379.1.20875 WP_003429379.1.20960 WP_003429379.1.21048 WP_003429379.1.21201 WP_003429379.1.21220 WP_003429379.1.21417 WP_003429379.1.21502 WP_003429379.1.21547 WP_003429379.1.21618 WP_003429379.1.21704 WP_003429379.1.21893 WP_003429379.1.22020 WP_003429379.1.22222 WP_003429379.1.22228 WP_003429379.1.22313 WP_003429379.1.22411 WP_003429379.1.22568 WP_003429379.1.22615 WP_003429379.1.22937 WP_003429379.1.23096 WP_003429379.1.23208 WP_003429379.1.23338 WP_003429379.1.2363 WP_003429379.1.24197 WP_003429379.1.24457 WP_003429379.1.24520 WP_003429379.1.24826 WP_003429379.1.24889 WP_003429379.1.24900 WP_003429379.1.24987 WP_003429379.1.25128 WP_003429379.1.25416 WP_003429379.1.25761 WP_003429379.1.26024 WP_003429379.1.26044 WP_003429379.1.26358 WP_003429379.1.26494 WP_003429379.1.26697 WP_003429379.1.26829 WP_003429379.1.26940 WP_003429379.1.2758 WP_003429379.1.27677 WP_003429379.1.27824 WP_003429379.1.27967 WP_003429379.1.27989 WP_003429379.1.28055 WP_003429379.1.28638 WP_003429379.1.28715 WP_003429379.1.28882 WP_003429379.1.28930 WP_003429379.1.2923 WP_003429379.1.293 WP_003429379.1.29757 WP_003429379.1.2982 WP_003429379.1.3024 WP_003429379.1.303 WP_003429379.1.3031 WP_003429379.1.30431 WP_003429379.1.30463 WP_003429379.1.30519 WP_003429379.1.31160 WP_003429379.1.31183 WP_003429379.1.31203 WP_003429379.1.31292 WP_003429379.1.31309 WP_003429379.1.31351 WP_003429379.1.31385 WP_003429379.1.31453 WP_003429379.1.31475 WP_003429379.1.31519 WP_003429379.1.31637 WP_003429379.1.31719 WP_003429379.1.31742 WP_003429379.1.31960 WP_003429379.1.31969 WP_003429379.1.32008 WP_003429379.1.32119 WP_003429379.1.32166 WP_003429379.1.32197 WP_003429379.1.32218 WP_003429379.1.32230 WP_003429379.1.32294 WP_003429379.1.32699 WP_003429379.1.32769 WP_003429379.1.32776 WP_003429379.1.33098 WP_003429379.1.33164 WP_003429379.1.33332 WP_003429379.1.3340 WP_003429379.1.33514 WP_003429379.1.33810 WP_003429379.1.34388 WP_003429379.1.34489 WP_003429379.1.34545 WP_003429379.1.34800 WP_003429379.1.34985 WP_003429379.1.34989 WP_003429379.1.35181 WP_003429379.1.35234 WP_003429379.1.3559 WP_003429379.1.35832 WP_003429379.1.35884 WP_003429379.1.36078 WP_003429379.1.36257 WP_003429379.1.36338 WP_003429379.1.36835 WP_003429379.1.37255 WP_003429379.1.37493 WP_003429379.1.37532 WP_003429379.1.37597 WP_003429379.1.37861 WP_003429379.1.3789 WP_003429379.1.37957 WP_003429379.1.38305 WP_003429379.1.38338 WP_003429379.1.38775 WP_003429379.1.38814 WP_003429379.1.38924 WP_003429379.1.38986 WP_003429379.1.39008 WP_003429379.1.39213 WP_003429379.1.39350 WP_003429379.1.39525 WP_003429379.1.39621 WP_003429379.1.39783 WP_003429379.1.39874 WP_003429379.1.39876 WP_003429379.1.39975 WP_003429379.1.39981 WP_003429379.1.40294 WP_003429379.1.40447 WP_003429379.1.40522 WP_003429379.1.41131 WP_003429379.1.4121 WP_003429379.1.41334 WP_003429379.1.41342 WP_003429379.1.4137 WP_003429379.1.41506 WP_003429379.1.41534 WP_003429379.1.41687 WP_003429379.1.41995 WP_003429379.1.42035 WP_003429379.1.42533 WP_003429379.1.42664 WP_003429379.1.43112 WP_003429379.1.4315 WP_003429379.1.4321 WP_003429379.1.43388 WP_003429379.1.43490 WP_003429379.1.43519 WP_003429379.1.43579 WP_003429379.1.43663 WP_003429379.1.43824 WP_003429379.1.4383 WP_003429379.1.44105 WP_003429379.1.44149 WP_003429379.1.44198 WP_003429379.1.44241 WP_003429379.1.44470 WP_003429379.1.44471 WP_003429379.1.44729 WP_003429379.1.45059 WP_003429379.1.45142 WP_003429379.1.45165 WP_003429379.1.45257 WP_003429379.1.45938 WP_003429379.1.45986 WP_003429379.1.46066 WP_003429379.1.46274 WP_003429379.1.46305 WP_003429379.1.46522 WP_003429379.1.4698 WP_003429379.1.47016 WP_003429379.1.47121 WP_003429379.1.47227 WP_003429379.1.47228 WP_003429379.1.47479 WP_003429379.1.47708 WP_003429379.1.47940 WP_003429379.1.48279 WP_003429379.1.4835 WP_003429379.1.48772 WP_003429379.1.48935 WP_003429379.1.48980 WP_003429379.1.48983 WP_003429379.1.48991 WP_003429379.1.49020 WP_003429379.1.49054 WP_003429379.1.49065 WP_003429379.1.49092 WP_003429379.1.49230 WP_003429379.1.49310 WP_003429379.1.49339 WP_003429379.1.50159 WP_003429379.1.50341 WP_003429379.1.51007 WP_003429379.1.51235 WP_003429379.1.51675 WP_003429379.1.51996 WP_003429379.1.52073 WP_003429379.1.52266 WP_003429379.1.52278 WP_003429379.1.52294 WP_003429379.1.52311 WP_003429379.1.52330 WP_003429379.1.52383 WP_003429379.1.52402 WP_003429379.1.52525 WP_003429379.1.52789 WP_003429379.1.52958 WP_003429379.1.52997 WP_003429379.1.53008 WP_003429379.1.53044 WP_003429379.1.53055 WP_003429379.1.5337 WP_003429379.1.53504 WP_003429379.1.53704 WP_003429379.1.53710 WP_003429379.1.53729 WP_003429379.1.53987 WP_003429379.1.5423 WP_003429379.1.54262 WP_003429379.1.54350 WP_003429379.1.54593 WP_003429379.1.54692 WP_003429379.1.55055 WP_003429379.1.55101 WP_003429379.1.5521 WP_003429379.1.55302 WP_003429379.1.55371 WP_003429379.1.55391 WP_003429379.1.5558 WP_003429379.1.559 WP_003429379.1.56006 WP_003429379.1.56217 WP_003429379.1.56252 WP_003429379.1.56323 WP_003429379.1.56337 WP_003429379.1.56556 WP_003429379.1.5661 WP_003429379.1.5664 WP_003429379.1.56664 WP_003429379.1.56711 WP_003429379.1.56754 WP_003429379.1.56998 WP_003429379.1.57099 WP_003429379.1.57337 WP_003429379.1.5750 WP_003429379.1.57711 WP_003429379.1.57827 WP_003429379.1.58015 WP_003429379.1.58304 WP_003429379.1.58315 WP_003429379.1.58323 WP_003429379.1.58463 WP_003429379.1.58531 WP_003429379.1.58665 WP_003429379.1.58711 WP_003429379.1.58818 WP_003429379.1.58956 WP_003429379.1.59032 WP_003429379.1.5905 WP_003429379.1.59588 WP_003429379.1.59618 WP_003429379.1.59628 WP_003429379.1.59707 WP_003429379.1.59752 WP_003429379.1.59990 WP_003429379.1.60040 WP_003429379.1.6031 WP_003429379.1.60482 WP_003429379.1.60563 WP_003429379.1.6070 WP_003429379.1.60957 WP_003429379.1.60998 WP_003429379.1.61042 WP_003429379.1.61140 WP_003429379.1.61293 WP_003429379.1.61492 WP_003429379.1.61679 WP_003429379.1.61866 WP_003429379.1.61972 WP_003429379.1.62049 WP_003429379.1.62095 WP_003429379.1.62340 WP_003429379.1.62577 WP_003429379.1.62624 WP_003429379.1.62637 WP_003429379.1.62941 WP_003429379.1.62986 WP_003429379.1.63059 WP_003429379.1.63237 WP_003429379.1.63239 WP_003429379.1.63248 WP_003429379.1.63378 WP_003429379.1.63570 WP_003429379.1.63581 WP_003429379.1.63599 WP_003429379.1.63696 WP_003429379.1.63804 WP_003429379.1.63853 WP_003429379.1.64020 WP_003429379.1.64092 WP_003429379.1.64197 WP_003429379.1.64369 WP_003429379.1.64447 WP_003429379.1.64546 WP_003429379.1.64573 WP_003429379.1.64859 WP_003429379.1.65064 WP_003429379.1.65369 WP_003429379.1.66084 WP_003429379.1.66119 WP_003429379.1.66439 WP_003429379.1.66474 WP_003429379.1.66565 WP_003429379.1.66587 WP_003429379.1.66608 WP_003429379.1.66701 WP_003429379.1.6671 WP_003429379.1.6675 WP_003429379.1.66805 WP_003429379.1.6685 WP_003429379.1.66887 WP_003429379.1.66888 WP_003429379.1.66900 WP_003429379.1.670 WP_003429379.1.67303 WP_003429379.1.67308 WP_003429379.1.6736 WP_003429379.1.67368 WP_003429379.1.67528 WP_003429379.1.67695 WP_003429379.1.67711 WP_003429379.1.67951 WP_003429379.1.68150 WP_003429379.1.68276 WP_003429379.1.68322 WP_003429379.1.68955 WP_003429379.1.6898 WP_003429379.1.68980 WP_003429379.1.69114 WP_003429379.1.69220 WP_003429379.1.69333 WP_003429379.1.69495 WP_003429379.1.69708 WP_003429379.1.6994 WP_003429379.1.700 WP_003429379.1.70152 WP_003429379.1.70179 WP_003429379.1.70231 WP_003429379.1.70695 WP_003429379.1.70710 WP_003429379.1.70820 WP_003429379.1.70886 WP_003429379.1.71079 WP_003429379.1.71119 WP_003429379.1.713 WP_003429379.1.71384 WP_003429379.1.71477 WP_003429379.1.7156 WP_003429379.1.71745 WP_003429379.1.7199 WP_003429379.1.72483 WP_003429379.1.72560 WP_003429379.1.72682 WP_003429379.1.72891 WP_003429379.1.72909 WP_003429379.1.72994 WP_003429379.1.7322 WP_003429379.1.73605 WP_003429379.1.73852 WP_003429379.1.73931 WP_003429379.1.74050 WP_003429379.1.74116 WP_003429379.1.74126 WP_003429379.1.74672 WP_003429379.1.74678 WP_003429379.1.74680 WP_003429379.1.75026 WP_003429379.1.751 WP_003429379.1.75210 WP_003429379.1.75226 WP_003429379.1.75287 WP_003429379.1.75454 WP_003429379.1.75638 WP_003429379.1.75659 WP_003429379.1.7650 WP_003429379.1.76550 WP_003429379.1.76552 WP_003429379.1.76621 WP_003429379.1.76664 WP_003429379.1.76687 WP_003429379.1.76793 WP_003429379.1.76813 WP_003429379.1.76882 WP_003429379.1.76924 WP_003429379.1.77092 WP_003429379.1.77102 WP_003429379.1.77509 WP_003429379.1.77544 WP_003429379.1.7755 WP_003429379.1.77782 WP_003429379.1.77842 WP_003429379.1.78123 WP_003429379.1.78579 WP_003429379.1.78949 WP_003429379.1.7916 WP_003429379.1.79199 WP_003429379.1.79309 WP_003429379.1.79344 WP_003429379.1.79437 WP_003429379.1.79611 WP_003429379.1.79680 WP_003429379.1.79703 WP_003429379.1.79956 WP_003429379.1.80144 WP_003429379.1.80342 WP_003429379.1.80455 WP_003429379.1.80575 WP_003429379.1.80963 WP_003429379.1.81035 WP_003429379.1.81044 WP_003429379.1.81208 WP_003429379.1.81299 WP_003429379.1.81351 WP_003429379.1.81402 WP_003429379.1.81777 WP_003429379.1.82002 WP_003429379.1.82150 WP_003429379.1.82169 WP_003429379.1.82335 WP_003429379.1.82920 WP_003429379.1.8314 WP_003429379.1.83175 WP_003429379.1.83255 WP_003429379.1.83287 WP_003429379.1.83288 WP_003429379.1.83477 WP_003429379.1.83515 WP_003429379.1.83822 WP_003429379.1.83918 WP_003429379.1.84253 WP_003429379.1.84528 WP_003429379.1.84646 WP_003429379.1.84843 WP_003429379.1.84880 WP_003429379.1.84923 WP_003429379.1.85020 WP_003429379.1.85127 WP_003429379.1.85214 WP_003429379.1.8527 WP_003429379.1.85420 WP_003429379.1.85442 WP_003429379.1.85863 WP_003429379.1.8587 WP_003429379.1.85932 WP_003429379.1.86008 WP_003429379.1.86011 WP_003429379.1.86088 WP_003429379.1.86116 WP_003429379.1.86328 WP_003429379.1.86395 WP_003429379.1.86534 WP_003429379.1.86618 WP_003429379.1.86743 WP_003429379.1.86767 WP_003429379.1.86837 WP_003429379.1.87058 WP_003429379.1.87195 WP_003429379.1.87326 WP_003429379.1.87454 WP_003429379.1.87714 WP_003429379.1.87723 WP_003429379.1.87730 WP_003429379.1.87932 WP_003429379.1.88091 WP_003429379.1.882 WP_003429379.1.88268 WP_003429379.1.88364 WP_003429379.1.88372 WP_003429379.1.88377 WP_003429379.1.88640 WP_003429379.1.88996 WP_003429379.1.89052 WP_003429379.1.89065 WP_003429379.1.89337 WP_003429379.1.89364 WP_003429379.1.89457 WP_003429379.1.89541 WP_003429379.1.89629 WP_003429379.1.89994 WP_003429379.1.90076 WP_003429379.1.90164 WP_003429379.1.90329 WP_003429379.1.9041 WP_003429379.1.90555 WP_003429379.1.90921 WP_003429379.1.90981 WP_003429379.1.91065 WP_003429379.1.91254 WP_003429379.1.91314 WP_003429379.1.91406 WP_003429379.1.91570 WP_003429379.1.91648 WP_003429379.1.92075 WP_003429379.1.92284 WP_003429379.1.92371 WP_003429379.1.92576 WP_003429379.1.92658 WP_003429379.1.92697 WP_003429379.1.92941 WP_003429379.1.93313 WP_003429379.1.93360 WP_003429379.1.93480 WP_003429379.1.93717 WP_003429379.1.93766 WP_003429379.1.93782 WP_003429379.1.93802 WP_003429379.1.9393 WP_003429379.1.94067 WP_003429379.1.94073 WP_003429379.1.94166 WP_003429379.1.94427 WP_003429379.1.94768 WP_003429379.1.94831 WP_003429379.1.94968 WP_003429379.1.95095 WP_003429379.1.95173 WP_003429379.1.9522 WP_003429379.1.95517 WP_003429379.1.9580 WP_003429379.1.96113 WP_003429379.1.96503 WP_003429379.1.96505 WP_003429379.1.96690 WP_003429379.1.96765 WP_003429379.1.97219 WP_003429379.1.97672 WP_003429379.1.97682 WP_003429379.1.97806 WP_003429379.1.98037 WP_003429379.1.98514 WP_003429379.1.98622 WP_003429379.1.98698 WP_003429379.1.98715 WP_003429379.1.98748 WP_003429379.1.98856 WP_003429379.1.98913 WP_003429379.1.98997 WP_003429379.1.99064 WP_003429379.1.99545 WP_003429379.1.99731 YP_001087928.1.32744 gi|384360629|ref|YP_006198481.1| 272563.CD1428 645462.CD196_1297 645463.CDR20291_1274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]