SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260683078|ref|YP_003214363.1| from Clostridium difficile CD196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260683078|ref|YP_003214363.1|
Domain Number 1 Region: 6-80
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.77e-18
Family GntR-like transcriptional regulators 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|260683078|ref|YP_003214363.1|
Sequence length 129
Comment GntR family transcriptional regulator [Clostridium difficile CD196]
Sequence
MVLNLDFNSDKSIYVQIKEEITKAIASGELKINESLPSVRSMAENIGVNLHTVNKSYNEL
KEEGFLNIDRRKGAIVAQLPMKIDNTTRQKNKLDLELLVAKSYLSGISKEEFLSLSSSLF
DKYEVKYYE
Download sequence
Identical sequences A0A031WGS6 A0A0H3N2N2 A0A0J0UB30 A0A125V4Z1 A0A1F2DAB4 C9YL59 G6B9X1 G6BFW8 Q18BY0 T4AV64 T4HUF6
gi|260683078|ref|YP_003214363.1| gi|384360666|ref|YP_006198518.1| 272563.CD1462 645462.CD196_1334 645463.CDR20291_1311 WP_003429441.1.100055 WP_003429441.1.100097 WP_003429441.1.100099 WP_003429441.1.100107 WP_003429441.1.100118 WP_003429441.1.100139 WP_003429441.1.100513 WP_003429441.1.100570 WP_003429441.1.100660 WP_003429441.1.100831 WP_003429441.1.100923 WP_003429441.1.100977 WP_003429441.1.101035 WP_003429441.1.101125 WP_003429441.1.101279 WP_003429441.1.10130 WP_003429441.1.101316 WP_003429441.1.101532 WP_003429441.1.101861 WP_003429441.1.101929 WP_003429441.1.102031 WP_003429441.1.102074 WP_003429441.1.102095 WP_003429441.1.10483 WP_003429441.1.10488 WP_003429441.1.10582 WP_003429441.1.10691 WP_003429441.1.10793 WP_003429441.1.10795 WP_003429441.1.11025 WP_003429441.1.11224 WP_003429441.1.11278 WP_003429441.1.11320 WP_003429441.1.11398 WP_003429441.1.1167 WP_003429441.1.1179 WP_003429441.1.11937 WP_003429441.1.11954 WP_003429441.1.11959 WP_003429441.1.12066 WP_003429441.1.12169 WP_003429441.1.12385 WP_003429441.1.1254 WP_003429441.1.12629 WP_003429441.1.12632 WP_003429441.1.12659 WP_003429441.1.1273 WP_003429441.1.12734 WP_003429441.1.12807 WP_003429441.1.12809 WP_003429441.1.12953 WP_003429441.1.13040 WP_003429441.1.13251 WP_003429441.1.13273 WP_003429441.1.13398 WP_003429441.1.13418 WP_003429441.1.13730 WP_003429441.1.13841 WP_003429441.1.13859 WP_003429441.1.14045 WP_003429441.1.141 WP_003429441.1.14170 WP_003429441.1.14177 WP_003429441.1.14205 WP_003429441.1.14259 WP_003429441.1.14330 WP_003429441.1.14352 WP_003429441.1.1445 WP_003429441.1.14457 WP_003429441.1.14483 WP_003429441.1.14579 WP_003429441.1.14674 WP_003429441.1.14686 WP_003429441.1.14698 WP_003429441.1.14848 WP_003429441.1.1494 WP_003429441.1.15083 WP_003429441.1.15097 WP_003429441.1.15192 WP_003429441.1.15205 WP_003429441.1.15310 WP_003429441.1.15435 WP_003429441.1.15908 WP_003429441.1.16012 WP_003429441.1.16185 WP_003429441.1.16190 WP_003429441.1.16376 WP_003429441.1.16520 WP_003429441.1.16728 WP_003429441.1.16897 WP_003429441.1.169 WP_003429441.1.16931 WP_003429441.1.16966 WP_003429441.1.1705 WP_003429441.1.17371 WP_003429441.1.17463 WP_003429441.1.17512 WP_003429441.1.17611 WP_003429441.1.17638 WP_003429441.1.17808 WP_003429441.1.17851 WP_003429441.1.17879 WP_003429441.1.17908 WP_003429441.1.17960 WP_003429441.1.18060 WP_003429441.1.18207 WP_003429441.1.18212 WP_003429441.1.18298 WP_003429441.1.1838 WP_003429441.1.18407 WP_003429441.1.18455 WP_003429441.1.18462 WP_003429441.1.18551 WP_003429441.1.18680 WP_003429441.1.18805 WP_003429441.1.18970 WP_003429441.1.19088 WP_003429441.1.19152 WP_003429441.1.1926 WP_003429441.1.19290 WP_003429441.1.1934 WP_003429441.1.19627 WP_003429441.1.19648 WP_003429441.1.19704 WP_003429441.1.19899 WP_003429441.1.19956 WP_003429441.1.1999 WP_003429441.1.2002 WP_003429441.1.20132 WP_003429441.1.20184 WP_003429441.1.20302 WP_003429441.1.20313 WP_003429441.1.20650 WP_003429441.1.20872 WP_003429441.1.20875 WP_003429441.1.20960 WP_003429441.1.21000 WP_003429441.1.21048 WP_003429441.1.21201 WP_003429441.1.21220 WP_003429441.1.21417 WP_003429441.1.21502 WP_003429441.1.21520 WP_003429441.1.21547 WP_003429441.1.21618 WP_003429441.1.21704 WP_003429441.1.21893 WP_003429441.1.22020 WP_003429441.1.22079 WP_003429441.1.22128 WP_003429441.1.22222 WP_003429441.1.22228 WP_003429441.1.22313 WP_003429441.1.22357 WP_003429441.1.22411 WP_003429441.1.22417 WP_003429441.1.22568 WP_003429441.1.22569 WP_003429441.1.22615 WP_003429441.1.22768 WP_003429441.1.22893 WP_003429441.1.22937 WP_003429441.1.23096 WP_003429441.1.23208 WP_003429441.1.23287 WP_003429441.1.23338 WP_003429441.1.2363 WP_003429441.1.24197 WP_003429441.1.24457 WP_003429441.1.24520 WP_003429441.1.24826 WP_003429441.1.24889 WP_003429441.1.24900 WP_003429441.1.24987 WP_003429441.1.25128 WP_003429441.1.25416 WP_003429441.1.25761 WP_003429441.1.26024 WP_003429441.1.26044 WP_003429441.1.26358 WP_003429441.1.26482 WP_003429441.1.26494 WP_003429441.1.26829 WP_003429441.1.26940 WP_003429441.1.27563 WP_003429441.1.2758 WP_003429441.1.27677 WP_003429441.1.27708 WP_003429441.1.27824 WP_003429441.1.27872 WP_003429441.1.27881 WP_003429441.1.27890 WP_003429441.1.27967 WP_003429441.1.27989 WP_003429441.1.27996 WP_003429441.1.28055 WP_003429441.1.28410 WP_003429441.1.28638 WP_003429441.1.28715 WP_003429441.1.28856 WP_003429441.1.28882 WP_003429441.1.28890 WP_003429441.1.28930 WP_003429441.1.2923 WP_003429441.1.293 WP_003429441.1.29600 WP_003429441.1.29757 WP_003429441.1.2982 WP_003429441.1.29891 WP_003429441.1.3024 WP_003429441.1.303 WP_003429441.1.3031 WP_003429441.1.30420 WP_003429441.1.30463 WP_003429441.1.30519 WP_003429441.1.30521 WP_003429441.1.30743 WP_003429441.1.30841 WP_003429441.1.30953 WP_003429441.1.31160 WP_003429441.1.31183 WP_003429441.1.31203 WP_003429441.1.31292 WP_003429441.1.31309 WP_003429441.1.31351 WP_003429441.1.31385 WP_003429441.1.31453 WP_003429441.1.31475 WP_003429441.1.31477 WP_003429441.1.31519 WP_003429441.1.31637 WP_003429441.1.31719 WP_003429441.1.31742 WP_003429441.1.31960 WP_003429441.1.31969 WP_003429441.1.32008 WP_003429441.1.32066 WP_003429441.1.32119 WP_003429441.1.32166 WP_003429441.1.32197 WP_003429441.1.32218 WP_003429441.1.32230 WP_003429441.1.32294 WP_003429441.1.32699 WP_003429441.1.32769 WP_003429441.1.32776 WP_003429441.1.32842 WP_003429441.1.33056 WP_003429441.1.33098 WP_003429441.1.33164 WP_003429441.1.33298 WP_003429441.1.33332 WP_003429441.1.33349 WP_003429441.1.3340 WP_003429441.1.33514 WP_003429441.1.33810 WP_003429441.1.34388 WP_003429441.1.34489 WP_003429441.1.34545 WP_003429441.1.34641 WP_003429441.1.34800 WP_003429441.1.34985 WP_003429441.1.34989 WP_003429441.1.35 WP_003429441.1.35002 WP_003429441.1.35137 WP_003429441.1.35181 WP_003429441.1.35187 WP_003429441.1.35234 WP_003429441.1.3559 WP_003429441.1.35709 WP_003429441.1.35832 WP_003429441.1.35884 WP_003429441.1.36078 WP_003429441.1.36257 WP_003429441.1.36338 WP_003429441.1.36835 WP_003429441.1.37255 WP_003429441.1.374 WP_003429441.1.37493 WP_003429441.1.37532 WP_003429441.1.37597 WP_003429441.1.37861 WP_003429441.1.3789 WP_003429441.1.37957 WP_003429441.1.37981 WP_003429441.1.38305 WP_003429441.1.38338 WP_003429441.1.38692 WP_003429441.1.38775 WP_003429441.1.38814 WP_003429441.1.38874 WP_003429441.1.38924 WP_003429441.1.38986 WP_003429441.1.39008 WP_003429441.1.3913 WP_003429441.1.39213 WP_003429441.1.39350 WP_003429441.1.39382 WP_003429441.1.39442 WP_003429441.1.39525 WP_003429441.1.39621 WP_003429441.1.39783 WP_003429441.1.39874 WP_003429441.1.39876 WP_003429441.1.39975 WP_003429441.1.39981 WP_003429441.1.40030 WP_003429441.1.40294 WP_003429441.1.40313 WP_003429441.1.40447 WP_003429441.1.40522 WP_003429441.1.40557 WP_003429441.1.407 WP_003429441.1.40775 WP_003429441.1.40891 WP_003429441.1.40959 WP_003429441.1.40966 WP_003429441.1.41131 WP_003429441.1.4121 WP_003429441.1.41334 WP_003429441.1.41342 WP_003429441.1.4137 WP_003429441.1.41506 WP_003429441.1.41534 WP_003429441.1.41641 WP_003429441.1.41687 WP_003429441.1.41818 WP_003429441.1.41995 WP_003429441.1.42035 WP_003429441.1.4204 WP_003429441.1.42066 WP_003429441.1.42532 WP_003429441.1.42533 WP_003429441.1.42610 WP_003429441.1.42664 WP_003429441.1.43112 WP_003429441.1.4315 WP_003429441.1.4321 WP_003429441.1.43388 WP_003429441.1.43490 WP_003429441.1.43519 WP_003429441.1.43579 WP_003429441.1.43663 WP_003429441.1.43824 WP_003429441.1.4383 WP_003429441.1.44030 WP_003429441.1.44105 WP_003429441.1.44149 WP_003429441.1.44198 WP_003429441.1.44241 WP_003429441.1.44470 WP_003429441.1.44471 WP_003429441.1.44729 WP_003429441.1.45017 WP_003429441.1.45059 WP_003429441.1.45142 WP_003429441.1.45165 WP_003429441.1.45209 WP_003429441.1.45257 WP_003429441.1.45352 WP_003429441.1.45554 WP_003429441.1.4573 WP_003429441.1.45938 WP_003429441.1.45986 WP_003429441.1.46066 WP_003429441.1.46274 WP_003429441.1.46280 WP_003429441.1.46305 WP_003429441.1.46522 WP_003429441.1.4698 WP_003429441.1.47016 WP_003429441.1.47121 WP_003429441.1.47173 WP_003429441.1.47227 WP_003429441.1.47228 WP_003429441.1.47479 WP_003429441.1.47615 WP_003429441.1.47708 WP_003429441.1.47729 WP_003429441.1.47940 WP_003429441.1.48220 WP_003429441.1.48246 WP_003429441.1.48279 WP_003429441.1.4835 WP_003429441.1.48733 WP_003429441.1.48746 WP_003429441.1.48935 WP_003429441.1.48980 WP_003429441.1.48983 WP_003429441.1.48991 WP_003429441.1.49020 WP_003429441.1.49054 WP_003429441.1.49065 WP_003429441.1.4908 WP_003429441.1.49092 WP_003429441.1.49230 WP_003429441.1.49339 WP_003429441.1.4948 WP_003429441.1.49633 WP_003429441.1.50159 WP_003429441.1.50341 WP_003429441.1.50460 WP_003429441.1.5073 WP_003429441.1.50865 WP_003429441.1.51007 WP_003429441.1.51235 WP_003429441.1.51675 WP_003429441.1.5187 WP_003429441.1.51996 WP_003429441.1.52073 WP_003429441.1.52266 WP_003429441.1.52278 WP_003429441.1.52294 WP_003429441.1.52311 WP_003429441.1.52330 WP_003429441.1.52383 WP_003429441.1.52402 WP_003429441.1.52466 WP_003429441.1.52525 WP_003429441.1.52789 WP_003429441.1.52958 WP_003429441.1.52997 WP_003429441.1.53008 WP_003429441.1.53044 WP_003429441.1.53055 WP_003429441.1.5337 WP_003429441.1.53504 WP_003429441.1.53704 WP_003429441.1.53710 WP_003429441.1.53729 WP_003429441.1.53987 WP_003429441.1.54058 WP_003429441.1.54153 WP_003429441.1.5423 WP_003429441.1.54262 WP_003429441.1.54350 WP_003429441.1.54586 WP_003429441.1.54593 WP_003429441.1.54692 WP_003429441.1.55055 WP_003429441.1.55101 WP_003429441.1.5521 WP_003429441.1.55302 WP_003429441.1.55371 WP_003429441.1.55391 WP_003429441.1.5558 WP_003429441.1.559 WP_003429441.1.56006 WP_003429441.1.56217 WP_003429441.1.56252 WP_003429441.1.56323 WP_003429441.1.56337 WP_003429441.1.56556 WP_003429441.1.5657 WP_003429441.1.5661 WP_003429441.1.5664 WP_003429441.1.56664 WP_003429441.1.56711 WP_003429441.1.56754 WP_003429441.1.56927 WP_003429441.1.56998 WP_003429441.1.57099 WP_003429441.1.57337 WP_003429441.1.5750 WP_003429441.1.57711 WP_003429441.1.57827 WP_003429441.1.58015 WP_003429441.1.58216 WP_003429441.1.58304 WP_003429441.1.58315 WP_003429441.1.58323 WP_003429441.1.58463 WP_003429441.1.58531 WP_003429441.1.58665 WP_003429441.1.58677 WP_003429441.1.58711 WP_003429441.1.58818 WP_003429441.1.58956 WP_003429441.1.59032 WP_003429441.1.5905 WP_003429441.1.59588 WP_003429441.1.59618 WP_003429441.1.59628 WP_003429441.1.59707 WP_003429441.1.59752 WP_003429441.1.59990 WP_003429441.1.60040 WP_003429441.1.6031 WP_003429441.1.60482 WP_003429441.1.60563 WP_003429441.1.6070 WP_003429441.1.60957 WP_003429441.1.60998 WP_003429441.1.61042 WP_003429441.1.61140 WP_003429441.1.61293 WP_003429441.1.61492 WP_003429441.1.61679 WP_003429441.1.61716 WP_003429441.1.61866 WP_003429441.1.61972 WP_003429441.1.62049 WP_003429441.1.62095 WP_003429441.1.62128 WP_003429441.1.62340 WP_003429441.1.62577 WP_003429441.1.62624 WP_003429441.1.62637 WP_003429441.1.62941 WP_003429441.1.62986 WP_003429441.1.63020 WP_003429441.1.63059 WP_003429441.1.63237 WP_003429441.1.63239 WP_003429441.1.63248 WP_003429441.1.63343 WP_003429441.1.63378 WP_003429441.1.63516 WP_003429441.1.63570 WP_003429441.1.63581 WP_003429441.1.63598 WP_003429441.1.63599 WP_003429441.1.63696 WP_003429441.1.63804 WP_003429441.1.63853 WP_003429441.1.63950 WP_003429441.1.64020 WP_003429441.1.64092 WP_003429441.1.64197 WP_003429441.1.64369 WP_003429441.1.64447 WP_003429441.1.64546 WP_003429441.1.64573 WP_003429441.1.64859 WP_003429441.1.65064 WP_003429441.1.65067 WP_003429441.1.65313 WP_003429441.1.65369 WP_003429441.1.65889 WP_003429441.1.66084 WP_003429441.1.66119 WP_003429441.1.66237 WP_003429441.1.66439 WP_003429441.1.66474 WP_003429441.1.66565 WP_003429441.1.66587 WP_003429441.1.66643 WP_003429441.1.66701 WP_003429441.1.6671 WP_003429441.1.6675 WP_003429441.1.66805 WP_003429441.1.66847 WP_003429441.1.6685 WP_003429441.1.66887 WP_003429441.1.66888 WP_003429441.1.66900 WP_003429441.1.670 WP_003429441.1.67303 WP_003429441.1.67308 WP_003429441.1.6736 WP_003429441.1.67368 WP_003429441.1.67528 WP_003429441.1.67689 WP_003429441.1.67695 WP_003429441.1.67711 WP_003429441.1.6792 WP_003429441.1.67951 WP_003429441.1.68150 WP_003429441.1.68276 WP_003429441.1.68322 WP_003429441.1.68955 WP_003429441.1.6898 WP_003429441.1.68980 WP_003429441.1.69114 WP_003429441.1.692 WP_003429441.1.69333 WP_003429441.1.69495 WP_003429441.1.69708 WP_003429441.1.6994 WP_003429441.1.700 WP_003429441.1.70152 WP_003429441.1.70179 WP_003429441.1.70231 WP_003429441.1.70320 WP_003429441.1.70695 WP_003429441.1.70710 WP_003429441.1.70820 WP_003429441.1.70886 WP_003429441.1.71079 WP_003429441.1.71119 WP_003429441.1.713 WP_003429441.1.71384 WP_003429441.1.71477 WP_003429441.1.7156 WP_003429441.1.71745 WP_003429441.1.7199 WP_003429441.1.72113 WP_003429441.1.72245 WP_003429441.1.72468 WP_003429441.1.72483 WP_003429441.1.72560 WP_003429441.1.72681 WP_003429441.1.72682 WP_003429441.1.72891 WP_003429441.1.72909 WP_003429441.1.72914 WP_003429441.1.72994 WP_003429441.1.73026 WP_003429441.1.73116 WP_003429441.1.7322 WP_003429441.1.73605 WP_003429441.1.73836 WP_003429441.1.73852 WP_003429441.1.73931 WP_003429441.1.74050 WP_003429441.1.74116 WP_003429441.1.74126 WP_003429441.1.74672 WP_003429441.1.74678 WP_003429441.1.74680 WP_003429441.1.74779 WP_003429441.1.74835 WP_003429441.1.74897 WP_003429441.1.75026 WP_003429441.1.751 WP_003429441.1.75210 WP_003429441.1.75226 WP_003429441.1.75287 WP_003429441.1.75638 WP_003429441.1.76207 WP_003429441.1.7650 WP_003429441.1.76550 WP_003429441.1.76552 WP_003429441.1.76603 WP_003429441.1.76621 WP_003429441.1.76664 WP_003429441.1.76687 WP_003429441.1.76793 WP_003429441.1.76813 WP_003429441.1.76882 WP_003429441.1.76924 WP_003429441.1.7696 WP_003429441.1.77092 WP_003429441.1.77102 WP_003429441.1.77473 WP_003429441.1.77509 WP_003429441.1.77544 WP_003429441.1.7755 WP_003429441.1.77639 WP_003429441.1.77782 WP_003429441.1.77842 WP_003429441.1.77942 WP_003429441.1.78123 WP_003429441.1.78579 WP_003429441.1.78949 WP_003429441.1.7916 WP_003429441.1.79199 WP_003429441.1.79221 WP_003429441.1.79309 WP_003429441.1.79344 WP_003429441.1.79437 WP_003429441.1.79611 WP_003429441.1.79680 WP_003429441.1.79703 WP_003429441.1.79836 WP_003429441.1.79956 WP_003429441.1.80052 WP_003429441.1.80144 WP_003429441.1.80342 WP_003429441.1.80379 WP_003429441.1.80455 WP_003429441.1.80504 WP_003429441.1.80575 WP_003429441.1.80963 WP_003429441.1.81035 WP_003429441.1.81044 WP_003429441.1.81208 WP_003429441.1.81299 WP_003429441.1.81351 WP_003429441.1.81402 WP_003429441.1.81777 WP_003429441.1.82002 WP_003429441.1.82084 WP_003429441.1.82150 WP_003429441.1.82169 WP_003429441.1.82335 WP_003429441.1.82635 WP_003429441.1.82701 WP_003429441.1.82920 WP_003429441.1.8314 WP_003429441.1.83148 WP_003429441.1.83175 WP_003429441.1.83287 WP_003429441.1.83288 WP_003429441.1.83318 WP_003429441.1.83348 WP_003429441.1.8336 WP_003429441.1.834 WP_003429441.1.83477 WP_003429441.1.83515 WP_003429441.1.83822 WP_003429441.1.83918 WP_003429441.1.84253 WP_003429441.1.84528 WP_003429441.1.84646 WP_003429441.1.84843 WP_003429441.1.84880 WP_003429441.1.84923 WP_003429441.1.85020 WP_003429441.1.85127 WP_003429441.1.85214 WP_003429441.1.85219 WP_003429441.1.8527 WP_003429441.1.85420 WP_003429441.1.85442 WP_003429441.1.85454 WP_003429441.1.85776 WP_003429441.1.85863 WP_003429441.1.8587 WP_003429441.1.85874 WP_003429441.1.85932 WP_003429441.1.86008 WP_003429441.1.86049 WP_003429441.1.86088 WP_003429441.1.86094 WP_003429441.1.86116 WP_003429441.1.86117 WP_003429441.1.86328 WP_003429441.1.86395 WP_003429441.1.86534 WP_003429441.1.86618 WP_003429441.1.86743 WP_003429441.1.86767 WP_003429441.1.86837 WP_003429441.1.86914 WP_003429441.1.87058 WP_003429441.1.87195 WP_003429441.1.87326 WP_003429441.1.87454 WP_003429441.1.87714 WP_003429441.1.87723 WP_003429441.1.87730 WP_003429441.1.87918 WP_003429441.1.87932 WP_003429441.1.88091 WP_003429441.1.882 WP_003429441.1.88268 WP_003429441.1.88332 WP_003429441.1.88364 WP_003429441.1.88372 WP_003429441.1.88377 WP_003429441.1.88608 WP_003429441.1.88640 WP_003429441.1.88996 WP_003429441.1.89052 WP_003429441.1.89065 WP_003429441.1.89196 WP_003429441.1.89337 WP_003429441.1.89364 WP_003429441.1.89457 WP_003429441.1.89541 WP_003429441.1.89629 WP_003429441.1.89697 WP_003429441.1.8984 WP_003429441.1.89994 WP_003429441.1.90076 WP_003429441.1.90101 WP_003429441.1.90164 WP_003429441.1.90329 WP_003429441.1.9041 WP_003429441.1.90491 WP_003429441.1.90555 WP_003429441.1.90643 WP_003429441.1.9083 WP_003429441.1.90921 WP_003429441.1.90938 WP_003429441.1.90981 WP_003429441.1.90985 WP_003429441.1.91065 WP_003429441.1.91254 WP_003429441.1.91314 WP_003429441.1.91406 WP_003429441.1.91570 WP_003429441.1.91648 WP_003429441.1.92075 WP_003429441.1.92284 WP_003429441.1.92371 WP_003429441.1.92576 WP_003429441.1.92658 WP_003429441.1.92697 WP_003429441.1.92941 WP_003429441.1.93044 WP_003429441.1.93171 WP_003429441.1.93313 WP_003429441.1.93360 WP_003429441.1.93480 WP_003429441.1.93615 WP_003429441.1.93687 WP_003429441.1.93717 WP_003429441.1.93766 WP_003429441.1.93782 WP_003429441.1.93798 WP_003429441.1.93802 WP_003429441.1.93830 WP_003429441.1.9393 WP_003429441.1.93968 WP_003429441.1.94067 WP_003429441.1.94073 WP_003429441.1.94166 WP_003429441.1.94427 WP_003429441.1.94768 WP_003429441.1.94831 WP_003429441.1.94968 WP_003429441.1.95095 WP_003429441.1.95173 WP_003429441.1.9522 WP_003429441.1.95350 WP_003429441.1.95517 WP_003429441.1.9580 WP_003429441.1.95847 WP_003429441.1.95893 WP_003429441.1.96113 WP_003429441.1.9635 WP_003429441.1.96503 WP_003429441.1.9666 WP_003429441.1.96690 WP_003429441.1.96765 WP_003429441.1.97219 WP_003429441.1.97458 WP_003429441.1.97672 WP_003429441.1.97682 WP_003429441.1.98037 WP_003429441.1.98514 WP_003429441.1.98622 WP_003429441.1.98698 WP_003429441.1.98715 WP_003429441.1.98748 WP_003429441.1.98856 WP_003429441.1.98913 WP_003429441.1.98997 WP_003429441.1.99064 WP_003429441.1.99134 WP_003429441.1.99333 WP_003429441.1.99542 WP_003429441.1.99545 WP_003429441.1.99731 WP_003429441.1.9986 YP_001087963.1.32744 gi|260686676|ref|YP_003217809.1| gi|126699066|ref|YP_001087963.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]