SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260683117|ref|YP_003214402.1| from Clostridium difficile CD196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260683117|ref|YP_003214402.1|
Domain Number 1 Region: 7-82
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000136
Family GntR-like transcriptional regulators 0.013
Further Details:      
 
Weak hits

Sequence:  gi|260683117|ref|YP_003214402.1|
Domain Number - Region: 66-119
Classification Level Classification E-value
Superfamily Triger factor/SurA peptide-binding domain-like 0.0451
Family Porin chaperone SurA, peptide-binding domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|260683117|ref|YP_003214402.1|
Sequence length 122
Comment transcriptional regulator [Clostridium difficile CD196]
Sequence
MKLVLNNEEPIFIQIARAIEDEILSNGIKEEEQVPSTTELSKLYKINPATVLKGINILVD
KNILYKKRGIGMFVSDGAKTIIKEARKENFKHNFVKNLLQEANKLEINREELVDIIINFK
ED
Download sequence
Identical sequences A0A031WA02 A0A0H3NB43 A0A0J0UAV8 A0A125V518 A0A1F2CXJ5 C9YL99 G6B5L1 G6BII4 Q18C21 T4AXG4 T4HVT3
gi|126699106|ref|YP_001088003.1| 272563.CD1503 645462.CD196_1374 645463.CDR20291_1351 WP_003427427.1.100055 WP_003427427.1.100097 WP_003427427.1.100099 WP_003427427.1.100107 WP_003427427.1.100118 WP_003427427.1.100139 WP_003427427.1.100513 WP_003427427.1.100570 WP_003427427.1.100660 WP_003427427.1.100831 WP_003427427.1.100923 WP_003427427.1.100977 WP_003427427.1.101035 WP_003427427.1.101125 WP_003427427.1.101279 WP_003427427.1.10130 WP_003427427.1.101316 WP_003427427.1.101532 WP_003427427.1.101929 WP_003427427.1.102074 WP_003427427.1.102095 WP_003427427.1.10483 WP_003427427.1.10488 WP_003427427.1.10582 WP_003427427.1.10691 WP_003427427.1.10793 WP_003427427.1.11025 WP_003427427.1.11224 WP_003427427.1.11278 WP_003427427.1.11320 WP_003427427.1.11398 WP_003427427.1.1167 WP_003427427.1.1179 WP_003427427.1.11937 WP_003427427.1.11954 WP_003427427.1.12066 WP_003427427.1.12169 WP_003427427.1.12385 WP_003427427.1.1254 WP_003427427.1.12629 WP_003427427.1.12632 WP_003427427.1.12659 WP_003427427.1.1273 WP_003427427.1.12734 WP_003427427.1.12807 WP_003427427.1.12809 WP_003427427.1.12953 WP_003427427.1.13040 WP_003427427.1.13251 WP_003427427.1.13273 WP_003427427.1.13398 WP_003427427.1.13418 WP_003427427.1.13730 WP_003427427.1.13841 WP_003427427.1.13859 WP_003427427.1.14045 WP_003427427.1.141 WP_003427427.1.14170 WP_003427427.1.14177 WP_003427427.1.14205 WP_003427427.1.14259 WP_003427427.1.14330 WP_003427427.1.14352 WP_003427427.1.1445 WP_003427427.1.14457 WP_003427427.1.14483 WP_003427427.1.14579 WP_003427427.1.14674 WP_003427427.1.14686 WP_003427427.1.14698 WP_003427427.1.14848 WP_003427427.1.1494 WP_003427427.1.15083 WP_003427427.1.15097 WP_003427427.1.15192 WP_003427427.1.15205 WP_003427427.1.15310 WP_003427427.1.15435 WP_003427427.1.15908 WP_003427427.1.16012 WP_003427427.1.16185 WP_003427427.1.16190 WP_003427427.1.16376 WP_003427427.1.16520 WP_003427427.1.16728 WP_003427427.1.16897 WP_003427427.1.169 WP_003427427.1.16931 WP_003427427.1.17371 WP_003427427.1.17413 WP_003427427.1.17463 WP_003427427.1.17512 WP_003427427.1.17611 WP_003427427.1.17638 WP_003427427.1.17808 WP_003427427.1.17851 WP_003427427.1.17879 WP_003427427.1.17908 WP_003427427.1.17960 WP_003427427.1.18060 WP_003427427.1.18207 WP_003427427.1.18212 WP_003427427.1.18298 WP_003427427.1.1838 WP_003427427.1.18455 WP_003427427.1.18462 WP_003427427.1.18551 WP_003427427.1.18680 WP_003427427.1.18805 WP_003427427.1.18970 WP_003427427.1.19088 WP_003427427.1.19152 WP_003427427.1.1926 WP_003427427.1.19290 WP_003427427.1.1934 WP_003427427.1.19627 WP_003427427.1.19648 WP_003427427.1.19704 WP_003427427.1.19899 WP_003427427.1.19956 WP_003427427.1.1999 WP_003427427.1.2002 WP_003427427.1.20132 WP_003427427.1.20184 WP_003427427.1.20313 WP_003427427.1.20650 WP_003427427.1.20872 WP_003427427.1.20875 WP_003427427.1.20960 WP_003427427.1.21000 WP_003427427.1.21048 WP_003427427.1.21201 WP_003427427.1.21220 WP_003427427.1.21417 WP_003427427.1.21502 WP_003427427.1.21520 WP_003427427.1.21618 WP_003427427.1.21704 WP_003427427.1.21893 WP_003427427.1.22020 WP_003427427.1.22079 WP_003427427.1.22222 WP_003427427.1.22228 WP_003427427.1.22313 WP_003427427.1.22357 WP_003427427.1.22411 WP_003427427.1.22417 WP_003427427.1.22568 WP_003427427.1.22569 WP_003427427.1.22615 WP_003427427.1.22768 WP_003427427.1.22893 WP_003427427.1.22937 WP_003427427.1.23096 WP_003427427.1.23208 WP_003427427.1.23287 WP_003427427.1.23338 WP_003427427.1.2363 WP_003427427.1.24197 WP_003427427.1.24457 WP_003427427.1.24520 WP_003427427.1.24826 WP_003427427.1.24889 WP_003427427.1.24900 WP_003427427.1.24987 WP_003427427.1.25128 WP_003427427.1.25416 WP_003427427.1.25761 WP_003427427.1.26024 WP_003427427.1.26044 WP_003427427.1.26358 WP_003427427.1.26482 WP_003427427.1.26494 WP_003427427.1.26829 WP_003427427.1.26940 WP_003427427.1.27563 WP_003427427.1.2758 WP_003427427.1.27677 WP_003427427.1.27708 WP_003427427.1.27824 WP_003427427.1.27872 WP_003427427.1.27881 WP_003427427.1.27890 WP_003427427.1.27967 WP_003427427.1.27989 WP_003427427.1.27996 WP_003427427.1.28055 WP_003427427.1.28410 WP_003427427.1.28638 WP_003427427.1.28715 WP_003427427.1.28856 WP_003427427.1.28882 WP_003427427.1.28890 WP_003427427.1.28930 WP_003427427.1.2923 WP_003427427.1.293 WP_003427427.1.29600 WP_003427427.1.29757 WP_003427427.1.2982 WP_003427427.1.29891 WP_003427427.1.3024 WP_003427427.1.303 WP_003427427.1.3031 WP_003427427.1.30420 WP_003427427.1.30463 WP_003427427.1.30519 WP_003427427.1.30521 WP_003427427.1.30743 WP_003427427.1.30841 WP_003427427.1.30953 WP_003427427.1.31160 WP_003427427.1.31183 WP_003427427.1.31203 WP_003427427.1.31292 WP_003427427.1.31309 WP_003427427.1.31351 WP_003427427.1.31385 WP_003427427.1.31453 WP_003427427.1.31475 WP_003427427.1.31477 WP_003427427.1.31519 WP_003427427.1.31637 WP_003427427.1.31719 WP_003427427.1.31742 WP_003427427.1.31960 WP_003427427.1.31969 WP_003427427.1.32008 WP_003427427.1.32066 WP_003427427.1.32119 WP_003427427.1.32166 WP_003427427.1.32197 WP_003427427.1.32218 WP_003427427.1.32230 WP_003427427.1.32294 WP_003427427.1.32699 WP_003427427.1.32769 WP_003427427.1.32776 WP_003427427.1.32842 WP_003427427.1.33056 WP_003427427.1.33098 WP_003427427.1.33164 WP_003427427.1.33298 WP_003427427.1.33332 WP_003427427.1.33349 WP_003427427.1.33514 WP_003427427.1.33810 WP_003427427.1.34388 WP_003427427.1.34489 WP_003427427.1.34545 WP_003427427.1.34641 WP_003427427.1.34800 WP_003427427.1.34985 WP_003427427.1.34989 WP_003427427.1.35 WP_003427427.1.35137 WP_003427427.1.35181 WP_003427427.1.35187 WP_003427427.1.35234 WP_003427427.1.3559 WP_003427427.1.35709 WP_003427427.1.35884 WP_003427427.1.36078 WP_003427427.1.36257 WP_003427427.1.36338 WP_003427427.1.36738 WP_003427427.1.37255 WP_003427427.1.374 WP_003427427.1.37493 WP_003427427.1.37597 WP_003427427.1.37861 WP_003427427.1.3789 WP_003427427.1.37957 WP_003427427.1.38305 WP_003427427.1.38338 WP_003427427.1.38692 WP_003427427.1.38775 WP_003427427.1.38814 WP_003427427.1.38874 WP_003427427.1.38924 WP_003427427.1.38986 WP_003427427.1.39008 WP_003427427.1.3913 WP_003427427.1.39213 WP_003427427.1.39350 WP_003427427.1.39382 WP_003427427.1.39442 WP_003427427.1.39525 WP_003427427.1.39621 WP_003427427.1.39783 WP_003427427.1.39874 WP_003427427.1.39876 WP_003427427.1.39975 WP_003427427.1.39981 WP_003427427.1.40030 WP_003427427.1.40294 WP_003427427.1.40313 WP_003427427.1.40447 WP_003427427.1.40522 WP_003427427.1.40557 WP_003427427.1.407 WP_003427427.1.40891 WP_003427427.1.40959 WP_003427427.1.40966 WP_003427427.1.41131 WP_003427427.1.4121 WP_003427427.1.41342 WP_003427427.1.4137 WP_003427427.1.41506 WP_003427427.1.41534 WP_003427427.1.41641 WP_003427427.1.41687 WP_003427427.1.41818 WP_003427427.1.41995 WP_003427427.1.42035 WP_003427427.1.4204 WP_003427427.1.42532 WP_003427427.1.42533 WP_003427427.1.42610 WP_003427427.1.42664 WP_003427427.1.43112 WP_003427427.1.4315 WP_003427427.1.4321 WP_003427427.1.43388 WP_003427427.1.43490 WP_003427427.1.43519 WP_003427427.1.43579 WP_003427427.1.43663 WP_003427427.1.43824 WP_003427427.1.4383 WP_003427427.1.44030 WP_003427427.1.44105 WP_003427427.1.44149 WP_003427427.1.44198 WP_003427427.1.44241 WP_003427427.1.44470 WP_003427427.1.44471 WP_003427427.1.44729 WP_003427427.1.45017 WP_003427427.1.45059 WP_003427427.1.45142 WP_003427427.1.45165 WP_003427427.1.45209 WP_003427427.1.45257 WP_003427427.1.45352 WP_003427427.1.45554 WP_003427427.1.4573 WP_003427427.1.45938 WP_003427427.1.45986 WP_003427427.1.46066 WP_003427427.1.46280 WP_003427427.1.46522 WP_003427427.1.4698 WP_003427427.1.47121 WP_003427427.1.47227 WP_003427427.1.47228 WP_003427427.1.47479 WP_003427427.1.47615 WP_003427427.1.47708 WP_003427427.1.47729 WP_003427427.1.47940 WP_003427427.1.48220 WP_003427427.1.48246 WP_003427427.1.48279 WP_003427427.1.48733 WP_003427427.1.48746 WP_003427427.1.48772 WP_003427427.1.48935 WP_003427427.1.48980 WP_003427427.1.48983 WP_003427427.1.48991 WP_003427427.1.49020 WP_003427427.1.49054 WP_003427427.1.49065 WP_003427427.1.4908 WP_003427427.1.49092 WP_003427427.1.49339 WP_003427427.1.4948 WP_003427427.1.49633 WP_003427427.1.50159 WP_003427427.1.50341 WP_003427427.1.50460 WP_003427427.1.5073 WP_003427427.1.50865 WP_003427427.1.51007 WP_003427427.1.51235 WP_003427427.1.51675 WP_003427427.1.51996 WP_003427427.1.52073 WP_003427427.1.52266 WP_003427427.1.52294 WP_003427427.1.52311 WP_003427427.1.52330 WP_003427427.1.52383 WP_003427427.1.52402 WP_003427427.1.52466 WP_003427427.1.52525 WP_003427427.1.52789 WP_003427427.1.52958 WP_003427427.1.52997 WP_003427427.1.53008 WP_003427427.1.53044 WP_003427427.1.53055 WP_003427427.1.5337 WP_003427427.1.53504 WP_003427427.1.53704 WP_003427427.1.53710 WP_003427427.1.53729 WP_003427427.1.53987 WP_003427427.1.54058 WP_003427427.1.54153 WP_003427427.1.5423 WP_003427427.1.54262 WP_003427427.1.54350 WP_003427427.1.54586 WP_003427427.1.54593 WP_003427427.1.54692 WP_003427427.1.55055 WP_003427427.1.55101 WP_003427427.1.5521 WP_003427427.1.55302 WP_003427427.1.55371 WP_003427427.1.55391 WP_003427427.1.5558 WP_003427427.1.559 WP_003427427.1.56006 WP_003427427.1.56217 WP_003427427.1.56252 WP_003427427.1.56323 WP_003427427.1.56337 WP_003427427.1.5657 WP_003427427.1.5661 WP_003427427.1.5664 WP_003427427.1.56664 WP_003427427.1.56711 WP_003427427.1.56754 WP_003427427.1.56927 WP_003427427.1.56998 WP_003427427.1.57099 WP_003427427.1.57337 WP_003427427.1.5750 WP_003427427.1.57711 WP_003427427.1.57827 WP_003427427.1.58015 WP_003427427.1.58216 WP_003427427.1.58304 WP_003427427.1.58315 WP_003427427.1.58323 WP_003427427.1.58463 WP_003427427.1.58531 WP_003427427.1.58665 WP_003427427.1.58677 WP_003427427.1.58711 WP_003427427.1.58818 WP_003427427.1.58956 WP_003427427.1.59032 WP_003427427.1.5905 WP_003427427.1.59588 WP_003427427.1.59618 WP_003427427.1.59628 WP_003427427.1.59707 WP_003427427.1.59752 WP_003427427.1.59990 WP_003427427.1.60040 WP_003427427.1.6031 WP_003427427.1.60482 WP_003427427.1.60563 WP_003427427.1.6070 WP_003427427.1.60957 WP_003427427.1.60998 WP_003427427.1.61042 WP_003427427.1.61140 WP_003427427.1.61293 WP_003427427.1.61492 WP_003427427.1.61679 WP_003427427.1.61716 WP_003427427.1.61866 WP_003427427.1.61972 WP_003427427.1.62049 WP_003427427.1.62095 WP_003427427.1.62340 WP_003427427.1.62577 WP_003427427.1.62624 WP_003427427.1.62637 WP_003427427.1.62941 WP_003427427.1.62986 WP_003427427.1.63020 WP_003427427.1.63059 WP_003427427.1.63237 WP_003427427.1.63239 WP_003427427.1.63248 WP_003427427.1.63343 WP_003427427.1.63378 WP_003427427.1.63516 WP_003427427.1.63570 WP_003427427.1.63581 WP_003427427.1.63598 WP_003427427.1.63696 WP_003427427.1.63804 WP_003427427.1.63853 WP_003427427.1.63950 WP_003427427.1.64020 WP_003427427.1.64092 WP_003427427.1.64197 WP_003427427.1.64369 WP_003427427.1.64447 WP_003427427.1.64546 WP_003427427.1.64573 WP_003427427.1.64859 WP_003427427.1.65064 WP_003427427.1.65067 WP_003427427.1.65313 WP_003427427.1.65369 WP_003427427.1.65889 WP_003427427.1.66084 WP_003427427.1.66119 WP_003427427.1.66237 WP_003427427.1.66439 WP_003427427.1.66474 WP_003427427.1.66608 WP_003427427.1.66643 WP_003427427.1.66701 WP_003427427.1.6671 WP_003427427.1.6675 WP_003427427.1.66805 WP_003427427.1.66847 WP_003427427.1.66887 WP_003427427.1.66888 WP_003427427.1.66900 WP_003427427.1.670 WP_003427427.1.67303 WP_003427427.1.67308 WP_003427427.1.6736 WP_003427427.1.67368 WP_003427427.1.67528 WP_003427427.1.67689 WP_003427427.1.67695 WP_003427427.1.67711 WP_003427427.1.6792 WP_003427427.1.67951 WP_003427427.1.68150 WP_003427427.1.68276 WP_003427427.1.68322 WP_003427427.1.68955 WP_003427427.1.6898 WP_003427427.1.68980 WP_003427427.1.69114 WP_003427427.1.692 WP_003427427.1.69220 WP_003427427.1.69333 WP_003427427.1.69495 WP_003427427.1.69708 WP_003427427.1.6994 WP_003427427.1.700 WP_003427427.1.70152 WP_003427427.1.70179 WP_003427427.1.70231 WP_003427427.1.70320 WP_003427427.1.70695 WP_003427427.1.70710 WP_003427427.1.70820 WP_003427427.1.71079 WP_003427427.1.71119 WP_003427427.1.713 WP_003427427.1.71384 WP_003427427.1.71477 WP_003427427.1.7156 WP_003427427.1.71745 WP_003427427.1.7199 WP_003427427.1.72113 WP_003427427.1.72245 WP_003427427.1.72468 WP_003427427.1.72483 WP_003427427.1.72560 WP_003427427.1.72681 WP_003427427.1.72682 WP_003427427.1.72891 WP_003427427.1.72909 WP_003427427.1.72914 WP_003427427.1.72994 WP_003427427.1.73026 WP_003427427.1.73116 WP_003427427.1.7322 WP_003427427.1.73605 WP_003427427.1.73836 WP_003427427.1.73852 WP_003427427.1.73931 WP_003427427.1.74050 WP_003427427.1.74116 WP_003427427.1.74126 WP_003427427.1.74672 WP_003427427.1.74678 WP_003427427.1.74680 WP_003427427.1.74779 WP_003427427.1.74835 WP_003427427.1.74897 WP_003427427.1.75026 WP_003427427.1.751 WP_003427427.1.75210 WP_003427427.1.75226 WP_003427427.1.75287 WP_003427427.1.75638 WP_003427427.1.76207 WP_003427427.1.7650 WP_003427427.1.76550 WP_003427427.1.76552 WP_003427427.1.76603 WP_003427427.1.76621 WP_003427427.1.76664 WP_003427427.1.76687 WP_003427427.1.76793 WP_003427427.1.76813 WP_003427427.1.76882 WP_003427427.1.76924 WP_003427427.1.7696 WP_003427427.1.77092 WP_003427427.1.77102 WP_003427427.1.77473 WP_003427427.1.77509 WP_003427427.1.7755 WP_003427427.1.77639 WP_003427427.1.77782 WP_003427427.1.77842 WP_003427427.1.77942 WP_003427427.1.78123 WP_003427427.1.78579 WP_003427427.1.78949 WP_003427427.1.7916 WP_003427427.1.79199 WP_003427427.1.79221 WP_003427427.1.79309 WP_003427427.1.79344 WP_003427427.1.79437 WP_003427427.1.79611 WP_003427427.1.79680 WP_003427427.1.79703 WP_003427427.1.79836 WP_003427427.1.79956 WP_003427427.1.80052 WP_003427427.1.80144 WP_003427427.1.80342 WP_003427427.1.80379 WP_003427427.1.80455 WP_003427427.1.80504 WP_003427427.1.80575 WP_003427427.1.80963 WP_003427427.1.81035 WP_003427427.1.81044 WP_003427427.1.81208 WP_003427427.1.81299 WP_003427427.1.81351 WP_003427427.1.81402 WP_003427427.1.81777 WP_003427427.1.82002 WP_003427427.1.82084 WP_003427427.1.82150 WP_003427427.1.82169 WP_003427427.1.82335 WP_003427427.1.82635 WP_003427427.1.82701 WP_003427427.1.82920 WP_003427427.1.8314 WP_003427427.1.83148 WP_003427427.1.83175 WP_003427427.1.83255 WP_003427427.1.83287 WP_003427427.1.83288 WP_003427427.1.83318 WP_003427427.1.83348 WP_003427427.1.8336 WP_003427427.1.834 WP_003427427.1.83477 WP_003427427.1.83515 WP_003427427.1.83822 WP_003427427.1.83918 WP_003427427.1.84253 WP_003427427.1.84528 WP_003427427.1.84646 WP_003427427.1.84843 WP_003427427.1.84880 WP_003427427.1.84923 WP_003427427.1.85020 WP_003427427.1.85127 WP_003427427.1.85214 WP_003427427.1.85219 WP_003427427.1.8527 WP_003427427.1.85420 WP_003427427.1.85442 WP_003427427.1.85454 WP_003427427.1.85776 WP_003427427.1.85863 WP_003427427.1.8587 WP_003427427.1.85874 WP_003427427.1.85932 WP_003427427.1.86008 WP_003427427.1.86049 WP_003427427.1.86088 WP_003427427.1.86094 WP_003427427.1.86116 WP_003427427.1.86117 WP_003427427.1.86328 WP_003427427.1.86395 WP_003427427.1.86534 WP_003427427.1.86618 WP_003427427.1.86743 WP_003427427.1.86767 WP_003427427.1.86837 WP_003427427.1.86914 WP_003427427.1.87058 WP_003427427.1.87195 WP_003427427.1.87326 WP_003427427.1.87454 WP_003427427.1.87714 WP_003427427.1.87723 WP_003427427.1.87730 WP_003427427.1.87918 WP_003427427.1.87932 WP_003427427.1.882 WP_003427427.1.88268 WP_003427427.1.88332 WP_003427427.1.88364 WP_003427427.1.88372 WP_003427427.1.88377 WP_003427427.1.88608 WP_003427427.1.88640 WP_003427427.1.88996 WP_003427427.1.89052 WP_003427427.1.89196 WP_003427427.1.89337 WP_003427427.1.89364 WP_003427427.1.89457 WP_003427427.1.89541 WP_003427427.1.89629 WP_003427427.1.89697 WP_003427427.1.8984 WP_003427427.1.89994 WP_003427427.1.90076 WP_003427427.1.90101 WP_003427427.1.90164 WP_003427427.1.9041 WP_003427427.1.90491 WP_003427427.1.90643 WP_003427427.1.9083 WP_003427427.1.90921 WP_003427427.1.90938 WP_003427427.1.90985 WP_003427427.1.91065 WP_003427427.1.91254 WP_003427427.1.91314 WP_003427427.1.91406 WP_003427427.1.91570 WP_003427427.1.91648 WP_003427427.1.92075 WP_003427427.1.92284 WP_003427427.1.92371 WP_003427427.1.92576 WP_003427427.1.92658 WP_003427427.1.92941 WP_003427427.1.93044 WP_003427427.1.93171 WP_003427427.1.93313 WP_003427427.1.93360 WP_003427427.1.93480 WP_003427427.1.93615 WP_003427427.1.93687 WP_003427427.1.93717 WP_003427427.1.93766 WP_003427427.1.93782 WP_003427427.1.93798 WP_003427427.1.93802 WP_003427427.1.93830 WP_003427427.1.9393 WP_003427427.1.93968 WP_003427427.1.94067 WP_003427427.1.94073 WP_003427427.1.94166 WP_003427427.1.94427 WP_003427427.1.94768 WP_003427427.1.94831 WP_003427427.1.94968 WP_003427427.1.95095 WP_003427427.1.95173 WP_003427427.1.9522 WP_003427427.1.95350 WP_003427427.1.95517 WP_003427427.1.9580 WP_003427427.1.95847 WP_003427427.1.95893 WP_003427427.1.96113 WP_003427427.1.9635 WP_003427427.1.96503 WP_003427427.1.9666 WP_003427427.1.96690 WP_003427427.1.96765 WP_003427427.1.97219 WP_003427427.1.97458 WP_003427427.1.97672 WP_003427427.1.97682 WP_003427427.1.97806 WP_003427427.1.98037 WP_003427427.1.98514 WP_003427427.1.98622 WP_003427427.1.98698 WP_003427427.1.98715 WP_003427427.1.98748 WP_003427427.1.98856 WP_003427427.1.98913 WP_003427427.1.98997 WP_003427427.1.99064 WP_003427427.1.99134 WP_003427427.1.99333 WP_003427427.1.99542 WP_003427427.1.99545 WP_003427427.1.99731 WP_003427427.1.9986 YP_001088003.1.32744 gi|260686715|ref|YP_003217848.1| gi|260683117|ref|YP_003214402.1| gi|384360706|ref|YP_006198558.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]