SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260683271|ref|YP_003214556.1| from Clostridium difficile CD196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260683271|ref|YP_003214556.1|
Domain Number 1 Region: 5-76
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000499
Family GntR-like transcriptional regulators 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|260683271|ref|YP_003214556.1|
Sequence length 118
Comment GntR family transcriptional regulator [Clostridium difficile CD196]
Sequence
MNFELDNTTPIYLQIVKYIKRQIVTGELKPGETIPSRREMALNLKVNLNTVQRAYKEMGD
MNIINTFKNYQSSVTVDENILKNLKLELINESLSVFIEDMKAINVSKEEVLKIIEDKY
Download sequence
Identical sequences A0A031WF03 A0A0H3N2A1 A0A125V5G7 A0A1F2D134 C9YLQ1 Q186G0 T4HSV0
272563.CD1606 645462.CD196_1529 645463.CDR20291_1504 WP_003436478.1.100055 WP_003436478.1.100097 WP_003436478.1.100107 WP_003436478.1.100118 WP_003436478.1.100139 WP_003436478.1.100570 WP_003436478.1.100660 WP_003436478.1.100831 WP_003436478.1.100977 WP_003436478.1.101035 WP_003436478.1.101125 WP_003436478.1.101279 WP_003436478.1.10130 WP_003436478.1.101316 WP_003436478.1.101532 WP_003436478.1.101861 WP_003436478.1.102031 WP_003436478.1.102074 WP_003436478.1.102095 WP_003436478.1.10483 WP_003436478.1.10488 WP_003436478.1.10582 WP_003436478.1.10691 WP_003436478.1.10793 WP_003436478.1.10795 WP_003436478.1.11025 WP_003436478.1.11224 WP_003436478.1.11278 WP_003436478.1.11320 WP_003436478.1.1167 WP_003436478.1.1179 WP_003436478.1.11937 WP_003436478.1.11959 WP_003436478.1.12066 WP_003436478.1.12169 WP_003436478.1.12385 WP_003436478.1.1254 WP_003436478.1.12629 WP_003436478.1.12632 WP_003436478.1.12659 WP_003436478.1.1273 WP_003436478.1.12734 WP_003436478.1.12807 WP_003436478.1.12809 WP_003436478.1.13040 WP_003436478.1.13251 WP_003436478.1.13273 WP_003436478.1.13398 WP_003436478.1.13418 WP_003436478.1.13730 WP_003436478.1.13841 WP_003436478.1.13859 WP_003436478.1.14045 WP_003436478.1.141 WP_003436478.1.14170 WP_003436478.1.14177 WP_003436478.1.14205 WP_003436478.1.1422 WP_003436478.1.14259 WP_003436478.1.14330 WP_003436478.1.14352 WP_003436478.1.1445 WP_003436478.1.14457 WP_003436478.1.14483 WP_003436478.1.14579 WP_003436478.1.14674 WP_003436478.1.14686 WP_003436478.1.14698 WP_003436478.1.14848 WP_003436478.1.1494 WP_003436478.1.15083 WP_003436478.1.15097 WP_003436478.1.15192 WP_003436478.1.15205 WP_003436478.1.15310 WP_003436478.1.15435 WP_003436478.1.15908 WP_003436478.1.16012 WP_003436478.1.16135 WP_003436478.1.16185 WP_003436478.1.16376 WP_003436478.1.16520 WP_003436478.1.16728 WP_003436478.1.169 WP_003436478.1.16931 WP_003436478.1.16966 WP_003436478.1.1705 WP_003436478.1.17371 WP_003436478.1.17413 WP_003436478.1.17463 WP_003436478.1.17512 WP_003436478.1.17611 WP_003436478.1.17638 WP_003436478.1.17808 WP_003436478.1.17851 WP_003436478.1.17879 WP_003436478.1.17908 WP_003436478.1.17960 WP_003436478.1.18060 WP_003436478.1.18207 WP_003436478.1.18212 WP_003436478.1.18298 WP_003436478.1.1838 WP_003436478.1.18407 WP_003436478.1.18455 WP_003436478.1.18462 WP_003436478.1.18551 WP_003436478.1.18680 WP_003436478.1.18805 WP_003436478.1.18970 WP_003436478.1.19088 WP_003436478.1.19152 WP_003436478.1.1926 WP_003436478.1.19290 WP_003436478.1.1934 WP_003436478.1.19648 WP_003436478.1.19704 WP_003436478.1.19899 WP_003436478.1.19956 WP_003436478.1.1999 WP_003436478.1.2002 WP_003436478.1.20132 WP_003436478.1.20184 WP_003436478.1.20302 WP_003436478.1.20313 WP_003436478.1.20481 WP_003436478.1.20650 WP_003436478.1.20728 WP_003436478.1.20872 WP_003436478.1.20875 WP_003436478.1.20960 WP_003436478.1.21000 WP_003436478.1.21048 WP_003436478.1.21220 WP_003436478.1.21417 WP_003436478.1.21520 WP_003436478.1.21547 WP_003436478.1.21618 WP_003436478.1.21704 WP_003436478.1.21893 WP_003436478.1.22020 WP_003436478.1.22079 WP_003436478.1.22222 WP_003436478.1.22228 WP_003436478.1.22411 WP_003436478.1.22417 WP_003436478.1.22568 WP_003436478.1.22569 WP_003436478.1.22615 WP_003436478.1.22768 WP_003436478.1.22893 WP_003436478.1.22937 WP_003436478.1.23096 WP_003436478.1.23208 WP_003436478.1.23287 WP_003436478.1.23338 WP_003436478.1.2363 WP_003436478.1.24197 WP_003436478.1.24457 WP_003436478.1.24520 WP_003436478.1.24900 WP_003436478.1.24987 WP_003436478.1.25128 WP_003436478.1.25416 WP_003436478.1.25761 WP_003436478.1.26024 WP_003436478.1.26358 WP_003436478.1.26482 WP_003436478.1.26494 WP_003436478.1.26697 WP_003436478.1.26829 WP_003436478.1.26940 WP_003436478.1.2758 WP_003436478.1.27677 WP_003436478.1.27708 WP_003436478.1.27872 WP_003436478.1.27881 WP_003436478.1.27890 WP_003436478.1.27967 WP_003436478.1.27989 WP_003436478.1.27996 WP_003436478.1.28055 WP_003436478.1.28410 WP_003436478.1.28638 WP_003436478.1.28715 WP_003436478.1.28856 WP_003436478.1.28882 WP_003436478.1.28890 WP_003436478.1.28930 WP_003436478.1.2923 WP_003436478.1.293 WP_003436478.1.29600 WP_003436478.1.29757 WP_003436478.1.2982 WP_003436478.1.29891 WP_003436478.1.3024 WP_003436478.1.303 WP_003436478.1.30420 WP_003436478.1.30431 WP_003436478.1.30463 WP_003436478.1.30519 WP_003436478.1.30521 WP_003436478.1.30743 WP_003436478.1.30841 WP_003436478.1.30953 WP_003436478.1.31160 WP_003436478.1.31183 WP_003436478.1.31203 WP_003436478.1.31292 WP_003436478.1.31309 WP_003436478.1.31351 WP_003436478.1.31385 WP_003436478.1.31475 WP_003436478.1.31477 WP_003436478.1.31519 WP_003436478.1.31637 WP_003436478.1.31719 WP_003436478.1.31742 WP_003436478.1.31960 WP_003436478.1.31969 WP_003436478.1.32008 WP_003436478.1.32066 WP_003436478.1.32119 WP_003436478.1.32166 WP_003436478.1.32197 WP_003436478.1.32230 WP_003436478.1.32294 WP_003436478.1.32699 WP_003436478.1.32769 WP_003436478.1.32776 WP_003436478.1.32842 WP_003436478.1.33056 WP_003436478.1.33098 WP_003436478.1.33164 WP_003436478.1.33298 WP_003436478.1.33332 WP_003436478.1.33349 WP_003436478.1.3340 WP_003436478.1.33514 WP_003436478.1.33810 WP_003436478.1.34388 WP_003436478.1.34489 WP_003436478.1.34545 WP_003436478.1.34641 WP_003436478.1.34800 WP_003436478.1.34985 WP_003436478.1.35 WP_003436478.1.35002 WP_003436478.1.35137 WP_003436478.1.35181 WP_003436478.1.35187 WP_003436478.1.35234 WP_003436478.1.3559 WP_003436478.1.35832 WP_003436478.1.35884 WP_003436478.1.36078 WP_003436478.1.36257 WP_003436478.1.36338 WP_003436478.1.36738 WP_003436478.1.36835 WP_003436478.1.37255 WP_003436478.1.374 WP_003436478.1.37493 WP_003436478.1.37532 WP_003436478.1.37597 WP_003436478.1.37861 WP_003436478.1.3789 WP_003436478.1.37957 WP_003436478.1.37981 WP_003436478.1.38305 WP_003436478.1.38338 WP_003436478.1.38692 WP_003436478.1.38775 WP_003436478.1.38814 WP_003436478.1.38874 WP_003436478.1.38924 WP_003436478.1.38986 WP_003436478.1.39008 WP_003436478.1.3913 WP_003436478.1.39213 WP_003436478.1.39350 WP_003436478.1.39382 WP_003436478.1.39442 WP_003436478.1.39525 WP_003436478.1.39621 WP_003436478.1.39783 WP_003436478.1.39874 WP_003436478.1.39876 WP_003436478.1.39975 WP_003436478.1.39981 WP_003436478.1.40030 WP_003436478.1.40294 WP_003436478.1.40313 WP_003436478.1.40447 WP_003436478.1.40522 WP_003436478.1.40557 WP_003436478.1.407 WP_003436478.1.40775 WP_003436478.1.40891 WP_003436478.1.40959 WP_003436478.1.40966 WP_003436478.1.41131 WP_003436478.1.4121 WP_003436478.1.41342 WP_003436478.1.4137 WP_003436478.1.41506 WP_003436478.1.41534 WP_003436478.1.41641 WP_003436478.1.41687 WP_003436478.1.41818 WP_003436478.1.41995 WP_003436478.1.42035 WP_003436478.1.4204 WP_003436478.1.42066 WP_003436478.1.42532 WP_003436478.1.42533 WP_003436478.1.42610 WP_003436478.1.42664 WP_003436478.1.43112 WP_003436478.1.4315 WP_003436478.1.4321 WP_003436478.1.43388 WP_003436478.1.43490 WP_003436478.1.43579 WP_003436478.1.43663 WP_003436478.1.43824 WP_003436478.1.4383 WP_003436478.1.44030 WP_003436478.1.44105 WP_003436478.1.44149 WP_003436478.1.44241 WP_003436478.1.44471 WP_003436478.1.44729 WP_003436478.1.45017 WP_003436478.1.45059 WP_003436478.1.45142 WP_003436478.1.45165 WP_003436478.1.45209 WP_003436478.1.45257 WP_003436478.1.45352 WP_003436478.1.45554 WP_003436478.1.4573 WP_003436478.1.45938 WP_003436478.1.45986 WP_003436478.1.46066 WP_003436478.1.46274 WP_003436478.1.46280 WP_003436478.1.46305 WP_003436478.1.46522 WP_003436478.1.4698 WP_003436478.1.47016 WP_003436478.1.47121 WP_003436478.1.47227 WP_003436478.1.47228 WP_003436478.1.47479 WP_003436478.1.47615 WP_003436478.1.47708 WP_003436478.1.47729 WP_003436478.1.47940 WP_003436478.1.48246 WP_003436478.1.48279 WP_003436478.1.4835 WP_003436478.1.48746 WP_003436478.1.48772 WP_003436478.1.48935 WP_003436478.1.48980 WP_003436478.1.48991 WP_003436478.1.49020 WP_003436478.1.49054 WP_003436478.1.49065 WP_003436478.1.4908 WP_003436478.1.49092 WP_003436478.1.49230 WP_003436478.1.49310 WP_003436478.1.49339 WP_003436478.1.4948 WP_003436478.1.49633 WP_003436478.1.50159 WP_003436478.1.50341 WP_003436478.1.5073 WP_003436478.1.50865 WP_003436478.1.51007 WP_003436478.1.51235 WP_003436478.1.51675 WP_003436478.1.51996 WP_003436478.1.52073 WP_003436478.1.52266 WP_003436478.1.52278 WP_003436478.1.52311 WP_003436478.1.52330 WP_003436478.1.52383 WP_003436478.1.52402 WP_003436478.1.52525 WP_003436478.1.52789 WP_003436478.1.52958 WP_003436478.1.53008 WP_003436478.1.53044 WP_003436478.1.53055 WP_003436478.1.5337 WP_003436478.1.53504 WP_003436478.1.53704 WP_003436478.1.53710 WP_003436478.1.53729 WP_003436478.1.53987 WP_003436478.1.54058 WP_003436478.1.54153 WP_003436478.1.5423 WP_003436478.1.54262 WP_003436478.1.54350 WP_003436478.1.54586 WP_003436478.1.54692 WP_003436478.1.55101 WP_003436478.1.5521 WP_003436478.1.55302 WP_003436478.1.55371 WP_003436478.1.55391 WP_003436478.1.5558 WP_003436478.1.559 WP_003436478.1.56006 WP_003436478.1.56217 WP_003436478.1.56252 WP_003436478.1.56323 WP_003436478.1.56337 WP_003436478.1.56556 WP_003436478.1.5657 WP_003436478.1.5661 WP_003436478.1.5664 WP_003436478.1.56664 WP_003436478.1.56711 WP_003436478.1.56927 WP_003436478.1.56998 WP_003436478.1.57337 WP_003436478.1.5750 WP_003436478.1.57711 WP_003436478.1.57827 WP_003436478.1.58015 WP_003436478.1.58216 WP_003436478.1.58304 WP_003436478.1.58315 WP_003436478.1.58323 WP_003436478.1.58463 WP_003436478.1.58531 WP_003436478.1.58677 WP_003436478.1.58711 WP_003436478.1.58818 WP_003436478.1.59032 WP_003436478.1.5905 WP_003436478.1.59588 WP_003436478.1.59618 WP_003436478.1.59628 WP_003436478.1.59707 WP_003436478.1.59752 WP_003436478.1.59990 WP_003436478.1.6031 WP_003436478.1.60482 WP_003436478.1.60563 WP_003436478.1.6070 WP_003436478.1.60957 WP_003436478.1.60998 WP_003436478.1.61042 WP_003436478.1.61140 WP_003436478.1.61293 WP_003436478.1.61492 WP_003436478.1.61679 WP_003436478.1.61716 WP_003436478.1.61866 WP_003436478.1.61972 WP_003436478.1.62049 WP_003436478.1.62095 WP_003436478.1.62128 WP_003436478.1.62340 WP_003436478.1.62577 WP_003436478.1.62624 WP_003436478.1.62637 WP_003436478.1.62941 WP_003436478.1.62986 WP_003436478.1.63020 WP_003436478.1.63059 WP_003436478.1.63248 WP_003436478.1.63343 WP_003436478.1.63516 WP_003436478.1.63570 WP_003436478.1.63581 WP_003436478.1.63598 WP_003436478.1.63599 WP_003436478.1.63696 WP_003436478.1.63804 WP_003436478.1.63853 WP_003436478.1.64020 WP_003436478.1.64092 WP_003436478.1.64197 WP_003436478.1.64447 WP_003436478.1.64546 WP_003436478.1.64573 WP_003436478.1.64859 WP_003436478.1.65064 WP_003436478.1.65067 WP_003436478.1.65369 WP_003436478.1.65889 WP_003436478.1.66084 WP_003436478.1.66119 WP_003436478.1.66237 WP_003436478.1.66439 WP_003436478.1.66474 WP_003436478.1.66565 WP_003436478.1.66587 WP_003436478.1.66643 WP_003436478.1.66701 WP_003436478.1.6671 WP_003436478.1.6675 WP_003436478.1.66805 WP_003436478.1.66847 WP_003436478.1.6685 WP_003436478.1.66887 WP_003436478.1.66888 WP_003436478.1.66900 WP_003436478.1.670 WP_003436478.1.67303 WP_003436478.1.67308 WP_003436478.1.6736 WP_003436478.1.67368 WP_003436478.1.67528 WP_003436478.1.67689 WP_003436478.1.67695 WP_003436478.1.67711 WP_003436478.1.6792 WP_003436478.1.67951 WP_003436478.1.68150 WP_003436478.1.68322 WP_003436478.1.68955 WP_003436478.1.6898 WP_003436478.1.68980 WP_003436478.1.69114 WP_003436478.1.692 WP_003436478.1.69220 WP_003436478.1.69333 WP_003436478.1.69495 WP_003436478.1.69708 WP_003436478.1.6994 WP_003436478.1.700 WP_003436478.1.70152 WP_003436478.1.70179 WP_003436478.1.70231 WP_003436478.1.70320 WP_003436478.1.70695 WP_003436478.1.70710 WP_003436478.1.70820 WP_003436478.1.70886 WP_003436478.1.71079 WP_003436478.1.71119 WP_003436478.1.713 WP_003436478.1.71384 WP_003436478.1.71477 WP_003436478.1.71745 WP_003436478.1.7199 WP_003436478.1.72113 WP_003436478.1.72245 WP_003436478.1.72468 WP_003436478.1.72483 WP_003436478.1.72560 WP_003436478.1.72682 WP_003436478.1.72891 WP_003436478.1.72909 WP_003436478.1.72914 WP_003436478.1.72994 WP_003436478.1.73026 WP_003436478.1.73116 WP_003436478.1.7322 WP_003436478.1.73852 WP_003436478.1.73931 WP_003436478.1.74116 WP_003436478.1.74126 WP_003436478.1.74672 WP_003436478.1.74678 WP_003436478.1.74680 WP_003436478.1.74835 WP_003436478.1.74897 WP_003436478.1.75026 WP_003436478.1.751 WP_003436478.1.75210 WP_003436478.1.75226 WP_003436478.1.75287 WP_003436478.1.75638 WP_003436478.1.75659 WP_003436478.1.76207 WP_003436478.1.7650 WP_003436478.1.76550 WP_003436478.1.76552 WP_003436478.1.76603 WP_003436478.1.76621 WP_003436478.1.76664 WP_003436478.1.76687 WP_003436478.1.76793 WP_003436478.1.76813 WP_003436478.1.76882 WP_003436478.1.76924 WP_003436478.1.7696 WP_003436478.1.77092 WP_003436478.1.77102 WP_003436478.1.77473 WP_003436478.1.77509 WP_003436478.1.77544 WP_003436478.1.7755 WP_003436478.1.77639 WP_003436478.1.77782 WP_003436478.1.77842 WP_003436478.1.77942 WP_003436478.1.78123 WP_003436478.1.78579 WP_003436478.1.78949 WP_003436478.1.7916 WP_003436478.1.79199 WP_003436478.1.79221 WP_003436478.1.79309 WP_003436478.1.79344 WP_003436478.1.79437 WP_003436478.1.79611 WP_003436478.1.79703 WP_003436478.1.79836 WP_003436478.1.79956 WP_003436478.1.80052 WP_003436478.1.80144 WP_003436478.1.80342 WP_003436478.1.80379 WP_003436478.1.80455 WP_003436478.1.80504 WP_003436478.1.80575 WP_003436478.1.80963 WP_003436478.1.81035 WP_003436478.1.81044 WP_003436478.1.81208 WP_003436478.1.81299 WP_003436478.1.81351 WP_003436478.1.81402 WP_003436478.1.81605 WP_003436478.1.81777 WP_003436478.1.82084 WP_003436478.1.82169 WP_003436478.1.82335 WP_003436478.1.82635 WP_003436478.1.82701 WP_003436478.1.82920 WP_003436478.1.8314 WP_003436478.1.83148 WP_003436478.1.83175 WP_003436478.1.83255 WP_003436478.1.83287 WP_003436478.1.83288 WP_003436478.1.83318 WP_003436478.1.83348 WP_003436478.1.834 WP_003436478.1.83477 WP_003436478.1.83515 WP_003436478.1.83822 WP_003436478.1.83918 WP_003436478.1.84528 WP_003436478.1.84646 WP_003436478.1.84843 WP_003436478.1.84880 WP_003436478.1.84923 WP_003436478.1.85127 WP_003436478.1.85214 WP_003436478.1.85219 WP_003436478.1.8527 WP_003436478.1.85420 WP_003436478.1.85442 WP_003436478.1.85454 WP_003436478.1.85776 WP_003436478.1.85863 WP_003436478.1.8587 WP_003436478.1.85874 WP_003436478.1.85932 WP_003436478.1.86008 WP_003436478.1.86011 WP_003436478.1.86049 WP_003436478.1.86088 WP_003436478.1.86094 WP_003436478.1.86116 WP_003436478.1.86117 WP_003436478.1.86328 WP_003436478.1.86395 WP_003436478.1.86534 WP_003436478.1.86743 WP_003436478.1.86767 WP_003436478.1.86837 WP_003436478.1.86914 WP_003436478.1.87058 WP_003436478.1.87195 WP_003436478.1.87326 WP_003436478.1.87454 WP_003436478.1.87714 WP_003436478.1.87730 WP_003436478.1.87918 WP_003436478.1.87932 WP_003436478.1.88091 WP_003436478.1.882 WP_003436478.1.88268 WP_003436478.1.88332 WP_003436478.1.88364 WP_003436478.1.88372 WP_003436478.1.88377 WP_003436478.1.88608 WP_003436478.1.88640 WP_003436478.1.88996 WP_003436478.1.89052 WP_003436478.1.89065 WP_003436478.1.89196 WP_003436478.1.89337 WP_003436478.1.89364 WP_003436478.1.89457 WP_003436478.1.89629 WP_003436478.1.89697 WP_003436478.1.89994 WP_003436478.1.90076 WP_003436478.1.90101 WP_003436478.1.90164 WP_003436478.1.90329 WP_003436478.1.9041 WP_003436478.1.90491 WP_003436478.1.90555 WP_003436478.1.90643 WP_003436478.1.9083 WP_003436478.1.90921 WP_003436478.1.90938 WP_003436478.1.90981 WP_003436478.1.91065 WP_003436478.1.91254 WP_003436478.1.91314 WP_003436478.1.91406 WP_003436478.1.91570 WP_003436478.1.91648 WP_003436478.1.92075 WP_003436478.1.92284 WP_003436478.1.92371 WP_003436478.1.92576 WP_003436478.1.92658 WP_003436478.1.92697 WP_003436478.1.92941 WP_003436478.1.93044 WP_003436478.1.93171 WP_003436478.1.93360 WP_003436478.1.93480 WP_003436478.1.93615 WP_003436478.1.93687 WP_003436478.1.93717 WP_003436478.1.93766 WP_003436478.1.93782 WP_003436478.1.93798 WP_003436478.1.93802 WP_003436478.1.93830 WP_003436478.1.9393 WP_003436478.1.94073 WP_003436478.1.94166 WP_003436478.1.94427 WP_003436478.1.94768 WP_003436478.1.94968 WP_003436478.1.95095 WP_003436478.1.9522 WP_003436478.1.95350 WP_003436478.1.9580 WP_003436478.1.95847 WP_003436478.1.95893 WP_003436478.1.96113 WP_003436478.1.9635 WP_003436478.1.96503 WP_003436478.1.96505 WP_003436478.1.9666 WP_003436478.1.96690 WP_003436478.1.96765 WP_003436478.1.97219 WP_003436478.1.97458 WP_003436478.1.97672 WP_003436478.1.97806 WP_003436478.1.98037 WP_003436478.1.98514 WP_003436478.1.98622 WP_003436478.1.98698 WP_003436478.1.98715 WP_003436478.1.98748 WP_003436478.1.98856 WP_003436478.1.98997 WP_003436478.1.99064 WP_003436478.1.99134 WP_003436478.1.99333 WP_003436478.1.99542 WP_003436478.1.99545 WP_003436478.1.99731 WP_003436478.1.9986 YP_001088107.1.32744 gi|260686867|ref|YP_003218000.1| gi|384360881|ref|YP_006198733.1| gi|260683271|ref|YP_003214556.1| gi|126699210|ref|YP_001088107.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]