SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260683282|ref|YP_003214567.1| from Clostridium difficile CD196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260683282|ref|YP_003214567.1|
Domain Number 1 Region: 5-84
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.93e-19
Family GntR-like transcriptional regulators 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|260683282|ref|YP_003214567.1|
Sequence length 122
Comment GntR family transcriptional regulator [Clostridium difficile CD196]
Sequence
MEWELDNNKPIYIQLVEHLKLKIISGEIKIGSKLETVRALAEDAEVNPNTMQKALTELER
QGLVYSQRTKGRFVTDDKEKIKAMKEEIANVEINTLKVTLEKLGYDRDEMLKLITENLKG
EL
Download sequence
Identical sequences A0A069ALS6 A0A0H3NBG1 A0A0J0TTB7 A0A125V5G1 A0A1F2D0W4 C9YLR2 G6BB68 G6BP07 Q186H1 T4AUB6 T4HSB4
gi|260683282|ref|YP_003214567.1| gi|126699221|ref|YP_001088118.1| gi|384360892|ref|YP_006198744.1| WP_003430051.1.100097 WP_003430051.1.100099 WP_003430051.1.100107 WP_003430051.1.100118 WP_003430051.1.100139 WP_003430051.1.100513 WP_003430051.1.100570 WP_003430051.1.100660 WP_003430051.1.100923 WP_003430051.1.100977 WP_003430051.1.101125 WP_003430051.1.101279 WP_003430051.1.10130 WP_003430051.1.101316 WP_003430051.1.101532 WP_003430051.1.101861 WP_003430051.1.101929 WP_003430051.1.102031 WP_003430051.1.102095 WP_003430051.1.10483 WP_003430051.1.10488 WP_003430051.1.10582 WP_003430051.1.10691 WP_003430051.1.10793 WP_003430051.1.10795 WP_003430051.1.11025 WP_003430051.1.11224 WP_003430051.1.11278 WP_003430051.1.11320 WP_003430051.1.11398 WP_003430051.1.1167 WP_003430051.1.1179 WP_003430051.1.11937 WP_003430051.1.11954 WP_003430051.1.12066 WP_003430051.1.12169 WP_003430051.1.12385 WP_003430051.1.1254 WP_003430051.1.12629 WP_003430051.1.12632 WP_003430051.1.12659 WP_003430051.1.1273 WP_003430051.1.12734 WP_003430051.1.12807 WP_003430051.1.12809 WP_003430051.1.12953 WP_003430051.1.13040 WP_003430051.1.13251 WP_003430051.1.13273 WP_003430051.1.13398 WP_003430051.1.13418 WP_003430051.1.13730 WP_003430051.1.13841 WP_003430051.1.13859 WP_003430051.1.14045 WP_003430051.1.141 WP_003430051.1.14170 WP_003430051.1.14177 WP_003430051.1.14205 WP_003430051.1.1422 WP_003430051.1.14259 WP_003430051.1.14330 WP_003430051.1.14352 WP_003430051.1.1445 WP_003430051.1.14457 WP_003430051.1.14483 WP_003430051.1.14579 WP_003430051.1.14674 WP_003430051.1.14686 WP_003430051.1.14698 WP_003430051.1.14848 WP_003430051.1.1494 WP_003430051.1.15083 WP_003430051.1.15097 WP_003430051.1.15192 WP_003430051.1.15205 WP_003430051.1.15310 WP_003430051.1.15435 WP_003430051.1.15908 WP_003430051.1.16012 WP_003430051.1.16135 WP_003430051.1.16185 WP_003430051.1.16376 WP_003430051.1.16520 WP_003430051.1.16728 WP_003430051.1.16897 WP_003430051.1.169 WP_003430051.1.16931 WP_003430051.1.16966 WP_003430051.1.1705 WP_003430051.1.17413 WP_003430051.1.17463 WP_003430051.1.17512 WP_003430051.1.17611 WP_003430051.1.17638 WP_003430051.1.17808 WP_003430051.1.17851 WP_003430051.1.17879 WP_003430051.1.17908 WP_003430051.1.18060 WP_003430051.1.18207 WP_003430051.1.18212 WP_003430051.1.18298 WP_003430051.1.1838 WP_003430051.1.18407 WP_003430051.1.18455 WP_003430051.1.18462 WP_003430051.1.18551 WP_003430051.1.18680 WP_003430051.1.18805 WP_003430051.1.19088 WP_003430051.1.19152 WP_003430051.1.1926 WP_003430051.1.1934 WP_003430051.1.19627 WP_003430051.1.19648 WP_003430051.1.19704 WP_003430051.1.19899 WP_003430051.1.19956 WP_003430051.1.20132 WP_003430051.1.20184 WP_003430051.1.20302 WP_003430051.1.20313 WP_003430051.1.20481 WP_003430051.1.20650 WP_003430051.1.20728 WP_003430051.1.20872 WP_003430051.1.20875 WP_003430051.1.20960 WP_003430051.1.21000 WP_003430051.1.21201 WP_003430051.1.21220 WP_003430051.1.21417 WP_003430051.1.21502 WP_003430051.1.21520 WP_003430051.1.21547 WP_003430051.1.21618 WP_003430051.1.21893 WP_003430051.1.22020 WP_003430051.1.22079 WP_003430051.1.22128 WP_003430051.1.22222 WP_003430051.1.22228 WP_003430051.1.22313 WP_003430051.1.22357 WP_003430051.1.22411 WP_003430051.1.22417 WP_003430051.1.22569 WP_003430051.1.22768 WP_003430051.1.22893 WP_003430051.1.22937 WP_003430051.1.23208 WP_003430051.1.23287 WP_003430051.1.23338 WP_003430051.1.2363 WP_003430051.1.24197 WP_003430051.1.24457 WP_003430051.1.24520 WP_003430051.1.24826 WP_003430051.1.24889 WP_003430051.1.24900 WP_003430051.1.25128 WP_003430051.1.25416 WP_003430051.1.25761 WP_003430051.1.26024 WP_003430051.1.26044 WP_003430051.1.26358 WP_003430051.1.26482 WP_003430051.1.26697 WP_003430051.1.26829 WP_003430051.1.26940 WP_003430051.1.2758 WP_003430051.1.27677 WP_003430051.1.27708 WP_003430051.1.27824 WP_003430051.1.27881 WP_003430051.1.27890 WP_003430051.1.27967 WP_003430051.1.27989 WP_003430051.1.27996 WP_003430051.1.28055 WP_003430051.1.28410 WP_003430051.1.28638 WP_003430051.1.28856 WP_003430051.1.28882 WP_003430051.1.28890 WP_003430051.1.28930 WP_003430051.1.2923 WP_003430051.1.29600 WP_003430051.1.2982 WP_003430051.1.29891 WP_003430051.1.3024 WP_003430051.1.303 WP_003430051.1.3031 WP_003430051.1.30420 WP_003430051.1.30431 WP_003430051.1.30463 WP_003430051.1.30519 WP_003430051.1.30521 WP_003430051.1.30743 WP_003430051.1.30841 WP_003430051.1.30953 WP_003430051.1.31160 WP_003430051.1.31183 WP_003430051.1.31203 WP_003430051.1.31309 WP_003430051.1.31351 WP_003430051.1.31385 WP_003430051.1.31453 WP_003430051.1.31475 WP_003430051.1.31477 WP_003430051.1.31519 WP_003430051.1.31637 WP_003430051.1.31719 WP_003430051.1.31742 WP_003430051.1.31960 WP_003430051.1.31969 WP_003430051.1.32008 WP_003430051.1.32066 WP_003430051.1.32119 WP_003430051.1.32166 WP_003430051.1.32197 WP_003430051.1.32218 WP_003430051.1.32230 WP_003430051.1.32294 WP_003430051.1.32699 WP_003430051.1.32769 WP_003430051.1.32776 WP_003430051.1.32842 WP_003430051.1.33056 WP_003430051.1.33098 WP_003430051.1.33164 WP_003430051.1.33332 WP_003430051.1.33349 WP_003430051.1.3340 WP_003430051.1.33810 WP_003430051.1.34388 WP_003430051.1.34489 WP_003430051.1.34545 WP_003430051.1.34641 WP_003430051.1.34800 WP_003430051.1.34985 WP_003430051.1.34989 WP_003430051.1.35002 WP_003430051.1.35137 WP_003430051.1.35181 WP_003430051.1.35187 WP_003430051.1.3559 WP_003430051.1.35709 WP_003430051.1.35832 WP_003430051.1.35884 WP_003430051.1.36257 WP_003430051.1.36338 WP_003430051.1.36738 WP_003430051.1.36835 WP_003430051.1.37255 WP_003430051.1.374 WP_003430051.1.37493 WP_003430051.1.37532 WP_003430051.1.37597 WP_003430051.1.37861 WP_003430051.1.3789 WP_003430051.1.37981 WP_003430051.1.38305 WP_003430051.1.38338 WP_003430051.1.38692 WP_003430051.1.38775 WP_003430051.1.38814 WP_003430051.1.38874 WP_003430051.1.38986 WP_003430051.1.39008 WP_003430051.1.3913 WP_003430051.1.39213 WP_003430051.1.39350 WP_003430051.1.39382 WP_003430051.1.39442 WP_003430051.1.39525 WP_003430051.1.39621 WP_003430051.1.39783 WP_003430051.1.39874 WP_003430051.1.39876 WP_003430051.1.39975 WP_003430051.1.39981 WP_003430051.1.40030 WP_003430051.1.40294 WP_003430051.1.40313 WP_003430051.1.40447 WP_003430051.1.40522 WP_003430051.1.40557 WP_003430051.1.407 WP_003430051.1.40775 WP_003430051.1.40891 WP_003430051.1.40959 WP_003430051.1.40966 WP_003430051.1.41131 WP_003430051.1.41334 WP_003430051.1.41342 WP_003430051.1.4137 WP_003430051.1.41506 WP_003430051.1.41534 WP_003430051.1.41641 WP_003430051.1.41818 WP_003430051.1.4204 WP_003430051.1.42066 WP_003430051.1.42532 WP_003430051.1.42533 WP_003430051.1.42610 WP_003430051.1.42664 WP_003430051.1.43112 WP_003430051.1.43519 WP_003430051.1.43579 WP_003430051.1.43663 WP_003430051.1.43824 WP_003430051.1.4383 WP_003430051.1.44030 WP_003430051.1.44105 WP_003430051.1.44149 WP_003430051.1.44198 WP_003430051.1.44241 WP_003430051.1.44470 WP_003430051.1.44471 WP_003430051.1.44729 WP_003430051.1.45017 WP_003430051.1.45059 WP_003430051.1.45142 WP_003430051.1.45165 WP_003430051.1.45209 WP_003430051.1.45257 WP_003430051.1.45352 WP_003430051.1.45554 WP_003430051.1.4573 WP_003430051.1.45938 WP_003430051.1.45986 WP_003430051.1.46066 WP_003430051.1.46274 WP_003430051.1.46280 WP_003430051.1.46305 WP_003430051.1.46522 WP_003430051.1.4698 WP_003430051.1.47016 WP_003430051.1.47121 WP_003430051.1.47173 WP_003430051.1.47227 WP_003430051.1.47228 WP_003430051.1.47479 WP_003430051.1.47708 WP_003430051.1.47729 WP_003430051.1.47940 WP_003430051.1.48220 WP_003430051.1.48279 WP_003430051.1.4835 WP_003430051.1.48733 WP_003430051.1.48746 WP_003430051.1.48772 WP_003430051.1.48935 WP_003430051.1.48980 WP_003430051.1.48983 WP_003430051.1.48991 WP_003430051.1.49065 WP_003430051.1.49092 WP_003430051.1.49230 WP_003430051.1.49310 WP_003430051.1.49339 WP_003430051.1.4948 WP_003430051.1.49633 WP_003430051.1.50159 WP_003430051.1.50341 WP_003430051.1.50460 WP_003430051.1.5073 WP_003430051.1.50865 WP_003430051.1.51235 WP_003430051.1.51675 WP_003430051.1.5187 WP_003430051.1.51996 WP_003430051.1.52073 WP_003430051.1.52266 WP_003430051.1.52278 WP_003430051.1.52294 WP_003430051.1.52311 WP_003430051.1.52330 WP_003430051.1.52383 WP_003430051.1.52402 WP_003430051.1.52466 WP_003430051.1.52789 WP_003430051.1.52958 WP_003430051.1.52997 WP_003430051.1.53044 WP_003430051.1.53055 WP_003430051.1.5337 WP_003430051.1.53504 WP_003430051.1.53704 WP_003430051.1.53710 WP_003430051.1.53729 WP_003430051.1.53987 WP_003430051.1.54058 WP_003430051.1.54153 WP_003430051.1.5423 WP_003430051.1.54262 WP_003430051.1.54350 WP_003430051.1.54593 WP_003430051.1.54692 WP_003430051.1.55055 WP_003430051.1.55101 WP_003430051.1.5521 WP_003430051.1.55302 WP_003430051.1.55371 WP_003430051.1.55391 WP_003430051.1.5558 WP_003430051.1.559 WP_003430051.1.56006 WP_003430051.1.56217 WP_003430051.1.56252 WP_003430051.1.56323 WP_003430051.1.56337 WP_003430051.1.56556 WP_003430051.1.5657 WP_003430051.1.5661 WP_003430051.1.5664 WP_003430051.1.56664 WP_003430051.1.56711 WP_003430051.1.56754 WP_003430051.1.56927 WP_003430051.1.56998 WP_003430051.1.57099 WP_003430051.1.57337 WP_003430051.1.5750 WP_003430051.1.57711 WP_003430051.1.57827 WP_003430051.1.58015 WP_003430051.1.58216 WP_003430051.1.58304 WP_003430051.1.58315 WP_003430051.1.58323 WP_003430051.1.58463 WP_003430051.1.58531 WP_003430051.1.58665 WP_003430051.1.58677 WP_003430051.1.58711 WP_003430051.1.58818 WP_003430051.1.58956 WP_003430051.1.59032 WP_003430051.1.5905 WP_003430051.1.59588 WP_003430051.1.59618 WP_003430051.1.59628 WP_003430051.1.59707 WP_003430051.1.59752 WP_003430051.1.59990 WP_003430051.1.60040 WP_003430051.1.6031 WP_003430051.1.60482 WP_003430051.1.60563 WP_003430051.1.6070 WP_003430051.1.60957 WP_003430051.1.60998 WP_003430051.1.61042 WP_003430051.1.61140 WP_003430051.1.61293 WP_003430051.1.61492 WP_003430051.1.61679 WP_003430051.1.61716 WP_003430051.1.61866 WP_003430051.1.61972 WP_003430051.1.62049 WP_003430051.1.62095 WP_003430051.1.62128 WP_003430051.1.62340 WP_003430051.1.62577 WP_003430051.1.62624 WP_003430051.1.62637 WP_003430051.1.62986 WP_003430051.1.63237 WP_003430051.1.63239 WP_003430051.1.63248 WP_003430051.1.63343 WP_003430051.1.63378 WP_003430051.1.63570 WP_003430051.1.63581 WP_003430051.1.63598 WP_003430051.1.63599 WP_003430051.1.63696 WP_003430051.1.63804 WP_003430051.1.63853 WP_003430051.1.63950 WP_003430051.1.64020 WP_003430051.1.64092 WP_003430051.1.64197 WP_003430051.1.64369 WP_003430051.1.64447 WP_003430051.1.64546 WP_003430051.1.64573 WP_003430051.1.64859 WP_003430051.1.65064 WP_003430051.1.65067 WP_003430051.1.65313 WP_003430051.1.65369 WP_003430051.1.65889 WP_003430051.1.66084 WP_003430051.1.66119 WP_003430051.1.66237 WP_003430051.1.66474 WP_003430051.1.66565 WP_003430051.1.66587 WP_003430051.1.66608 WP_003430051.1.66643 WP_003430051.1.66701 WP_003430051.1.6671 WP_003430051.1.6675 WP_003430051.1.66805 WP_003430051.1.66847 WP_003430051.1.6685 WP_003430051.1.66887 WP_003430051.1.66888 WP_003430051.1.66900 WP_003430051.1.670 WP_003430051.1.67303 WP_003430051.1.67308 WP_003430051.1.6736 WP_003430051.1.67528 WP_003430051.1.67689 WP_003430051.1.67695 WP_003430051.1.67711 WP_003430051.1.6792 WP_003430051.1.68150 WP_003430051.1.68276 WP_003430051.1.68322 WP_003430051.1.68955 WP_003430051.1.6898 WP_003430051.1.68980 WP_003430051.1.69114 WP_003430051.1.692 WP_003430051.1.69220 WP_003430051.1.69333 WP_003430051.1.69495 WP_003430051.1.69708 WP_003430051.1.6994 WP_003430051.1.700 WP_003430051.1.70152 WP_003430051.1.70179 WP_003430051.1.70231 WP_003430051.1.70320 WP_003430051.1.70695 WP_003430051.1.70710 WP_003430051.1.70820 WP_003430051.1.70886 WP_003430051.1.71079 WP_003430051.1.71119 WP_003430051.1.71384 WP_003430051.1.71477 WP_003430051.1.7156 WP_003430051.1.71745 WP_003430051.1.7199 WP_003430051.1.72245 WP_003430051.1.72468 WP_003430051.1.72560 WP_003430051.1.72681 WP_003430051.1.72682 WP_003430051.1.72909 WP_003430051.1.72914 WP_003430051.1.72994 WP_003430051.1.73026 WP_003430051.1.73116 WP_003430051.1.7322 WP_003430051.1.73605 WP_003430051.1.73836 WP_003430051.1.73852 WP_003430051.1.73931 WP_003430051.1.74050 WP_003430051.1.74116 WP_003430051.1.74126 WP_003430051.1.74672 WP_003430051.1.74678 WP_003430051.1.74680 WP_003430051.1.74835 WP_003430051.1.74897 WP_003430051.1.75026 WP_003430051.1.751 WP_003430051.1.75210 WP_003430051.1.75226 WP_003430051.1.75287 WP_003430051.1.75454 WP_003430051.1.75638 WP_003430051.1.75659 WP_003430051.1.76207 WP_003430051.1.7650 WP_003430051.1.76550 WP_003430051.1.76552 WP_003430051.1.76603 WP_003430051.1.76621 WP_003430051.1.76664 WP_003430051.1.76687 WP_003430051.1.76793 WP_003430051.1.76813 WP_003430051.1.76882 WP_003430051.1.76924 WP_003430051.1.7696 WP_003430051.1.77092 WP_003430051.1.77102 WP_003430051.1.77473 WP_003430051.1.77509 WP_003430051.1.77544 WP_003430051.1.7755 WP_003430051.1.77639 WP_003430051.1.77782 WP_003430051.1.77842 WP_003430051.1.77942 WP_003430051.1.78123 WP_003430051.1.78579 WP_003430051.1.78949 WP_003430051.1.7916 WP_003430051.1.79199 WP_003430051.1.79221 WP_003430051.1.79309 WP_003430051.1.79344 WP_003430051.1.79611 WP_003430051.1.79680 WP_003430051.1.79703 WP_003430051.1.79836 WP_003430051.1.79956 WP_003430051.1.80342 WP_003430051.1.80379 WP_003430051.1.80455 WP_003430051.1.80504 WP_003430051.1.80575 WP_003430051.1.80963 WP_003430051.1.81035 WP_003430051.1.81044 WP_003430051.1.81208 WP_003430051.1.81351 WP_003430051.1.81402 WP_003430051.1.81605 WP_003430051.1.81777 WP_003430051.1.82002 WP_003430051.1.82084 WP_003430051.1.82150 WP_003430051.1.82169 WP_003430051.1.82335 WP_003430051.1.82635 WP_003430051.1.82920 WP_003430051.1.8314 WP_003430051.1.83148 WP_003430051.1.83255 WP_003430051.1.83287 WP_003430051.1.83288 WP_003430051.1.83348 WP_003430051.1.8336 WP_003430051.1.834 WP_003430051.1.83477 WP_003430051.1.83515 WP_003430051.1.83822 WP_003430051.1.83918 WP_003430051.1.84253 WP_003430051.1.84528 WP_003430051.1.84646 WP_003430051.1.84843 WP_003430051.1.84880 WP_003430051.1.84923 WP_003430051.1.85020 WP_003430051.1.85127 WP_003430051.1.85214 WP_003430051.1.85219 WP_003430051.1.8527 WP_003430051.1.85420 WP_003430051.1.85442 WP_003430051.1.85454 WP_003430051.1.8587 WP_003430051.1.85874 WP_003430051.1.85932 WP_003430051.1.86011 WP_003430051.1.86088 WP_003430051.1.86094 WP_003430051.1.86116 WP_003430051.1.86117 WP_003430051.1.86328 WP_003430051.1.86395 WP_003430051.1.86534 WP_003430051.1.86618 WP_003430051.1.86743 WP_003430051.1.86767 WP_003430051.1.86837 WP_003430051.1.86914 WP_003430051.1.87058 WP_003430051.1.87195 WP_003430051.1.87326 WP_003430051.1.87454 WP_003430051.1.87714 WP_003430051.1.87723 WP_003430051.1.87730 WP_003430051.1.87918 WP_003430051.1.87932 WP_003430051.1.88091 WP_003430051.1.882 WP_003430051.1.88268 WP_003430051.1.88332 WP_003430051.1.88364 WP_003430051.1.88372 WP_003430051.1.88377 WP_003430051.1.88608 WP_003430051.1.88640 WP_003430051.1.88996 WP_003430051.1.89065 WP_003430051.1.89196 WP_003430051.1.89337 WP_003430051.1.89364 WP_003430051.1.89541 WP_003430051.1.89697 WP_003430051.1.8984 WP_003430051.1.89994 WP_003430051.1.90076 WP_003430051.1.90101 WP_003430051.1.90164 WP_003430051.1.90329 WP_003430051.1.9041 WP_003430051.1.90491 WP_003430051.1.90555 WP_003430051.1.90643 WP_003430051.1.9083 WP_003430051.1.90921 WP_003430051.1.90938 WP_003430051.1.90981 WP_003430051.1.90985 WP_003430051.1.91065 WP_003430051.1.91254 WP_003430051.1.91314 WP_003430051.1.91406 WP_003430051.1.91570 WP_003430051.1.91648 WP_003430051.1.92075 WP_003430051.1.92284 WP_003430051.1.92371 WP_003430051.1.92576 WP_003430051.1.92658 WP_003430051.1.92697 WP_003430051.1.92941 WP_003430051.1.93044 WP_003430051.1.93171 WP_003430051.1.93313 WP_003430051.1.93360 WP_003430051.1.93615 WP_003430051.1.93687 WP_003430051.1.93717 WP_003430051.1.93766 WP_003430051.1.93782 WP_003430051.1.93798 WP_003430051.1.93802 WP_003430051.1.93830 WP_003430051.1.9393 WP_003430051.1.93968 WP_003430051.1.94067 WP_003430051.1.94073 WP_003430051.1.94166 WP_003430051.1.94427 WP_003430051.1.94768 WP_003430051.1.94831 WP_003430051.1.94968 WP_003430051.1.95095 WP_003430051.1.95173 WP_003430051.1.9522 WP_003430051.1.95350 WP_003430051.1.95517 WP_003430051.1.9580 WP_003430051.1.95847 WP_003430051.1.95893 WP_003430051.1.96113 WP_003430051.1.9635 WP_003430051.1.96503 WP_003430051.1.96505 WP_003430051.1.9666 WP_003430051.1.96690 WP_003430051.1.96765 WP_003430051.1.97458 WP_003430051.1.97672 WP_003430051.1.97682 WP_003430051.1.97806 WP_003430051.1.98037 WP_003430051.1.98514 WP_003430051.1.98622 WP_003430051.1.98698 WP_003430051.1.98715 WP_003430051.1.98748 WP_003430051.1.98856 WP_003430051.1.98913 WP_003430051.1.98997 WP_003430051.1.99064 WP_003430051.1.99134 WP_003430051.1.99333 WP_003430051.1.99542 WP_003430051.1.99545 WP_003430051.1.99731 WP_003430051.1.9986 YP_001088118.1.32744 272563.CD1617 645462.CD196_1540 645463.CDR20291_1515 gi|260686878|ref|YP_003218011.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]