SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260683357|ref|YP_003214642.1| from Clostridium difficile CD196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260683357|ref|YP_003214642.1|
Domain Number 1 Region: 1-96
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.11e-24
Family ArsR-like transcriptional regulators 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|260683357|ref|YP_003214642.1|
Sequence length 122
Comment ArsR family transcriptional regulator [Clostridium difficile CD196]
Sequence
MENLVKIFKALSDETRLNILILVSKRNICQKGISKYLGISDSAVSQHIKILKDVGIITGY
KEGYYVLYHINKESFNICVDFINSMLSNSSESFIDVFDVNTIHLGCSKECKSIKKCCKRR
EK
Download sequence
Identical sequences A0A031WI10 A0A0H3NBL0 A0A0J0TTH0 A0A125V5G6 A0A1F2D1H7 C9YLY7 G6BBE1 G6BPL0 Q186P8 T4AV88
gi|260686952|ref|YP_003218085.1| gi|384360968|ref|YP_006198820.1| gi|260683357|ref|YP_003214642.1| 272563.CD1692 645462.CD196_1615 645463.CDR20291_1590 WP_003430158.1.100055 WP_003430158.1.100097 WP_003430158.1.100099 WP_003430158.1.100107 WP_003430158.1.100118 WP_003430158.1.100139 WP_003430158.1.100513 WP_003430158.1.100570 WP_003430158.1.100660 WP_003430158.1.100923 WP_003430158.1.100977 WP_003430158.1.101035 WP_003430158.1.101125 WP_003430158.1.101279 WP_003430158.1.10130 WP_003430158.1.101316 WP_003430158.1.101532 WP_003430158.1.101861 WP_003430158.1.101929 WP_003430158.1.102031 WP_003430158.1.102074 WP_003430158.1.102095 WP_003430158.1.10483 WP_003430158.1.10488 WP_003430158.1.10582 WP_003430158.1.10691 WP_003430158.1.10793 WP_003430158.1.10795 WP_003430158.1.11025 WP_003430158.1.11224 WP_003430158.1.11278 WP_003430158.1.11320 WP_003430158.1.11398 WP_003430158.1.1167 WP_003430158.1.1179 WP_003430158.1.11937 WP_003430158.1.11954 WP_003430158.1.11959 WP_003430158.1.12066 WP_003430158.1.12169 WP_003430158.1.12385 WP_003430158.1.1254 WP_003430158.1.12629 WP_003430158.1.12632 WP_003430158.1.12659 WP_003430158.1.1273 WP_003430158.1.12734 WP_003430158.1.12807 WP_003430158.1.12809 WP_003430158.1.12953 WP_003430158.1.13040 WP_003430158.1.13251 WP_003430158.1.13273 WP_003430158.1.13398 WP_003430158.1.13418 WP_003430158.1.13730 WP_003430158.1.13841 WP_003430158.1.13859 WP_003430158.1.14045 WP_003430158.1.141 WP_003430158.1.14170 WP_003430158.1.14177 WP_003430158.1.14205 WP_003430158.1.1422 WP_003430158.1.14259 WP_003430158.1.14330 WP_003430158.1.14352 WP_003430158.1.1445 WP_003430158.1.14457 WP_003430158.1.14483 WP_003430158.1.14579 WP_003430158.1.14674 WP_003430158.1.14686 WP_003430158.1.14698 WP_003430158.1.14848 WP_003430158.1.1494 WP_003430158.1.15083 WP_003430158.1.15097 WP_003430158.1.15192 WP_003430158.1.15205 WP_003430158.1.15310 WP_003430158.1.15435 WP_003430158.1.15908 WP_003430158.1.16012 WP_003430158.1.16135 WP_003430158.1.16185 WP_003430158.1.16190 WP_003430158.1.16376 WP_003430158.1.16520 WP_003430158.1.16728 WP_003430158.1.16897 WP_003430158.1.169 WP_003430158.1.16931 WP_003430158.1.16966 WP_003430158.1.1705 WP_003430158.1.17371 WP_003430158.1.17413 WP_003430158.1.17463 WP_003430158.1.17512 WP_003430158.1.17611 WP_003430158.1.17638 WP_003430158.1.17808 WP_003430158.1.17851 WP_003430158.1.17879 WP_003430158.1.17908 WP_003430158.1.17960 WP_003430158.1.18060 WP_003430158.1.18207 WP_003430158.1.18212 WP_003430158.1.18298 WP_003430158.1.1838 WP_003430158.1.18407 WP_003430158.1.18455 WP_003430158.1.18462 WP_003430158.1.18551 WP_003430158.1.18680 WP_003430158.1.18805 WP_003430158.1.18970 WP_003430158.1.19088 WP_003430158.1.19152 WP_003430158.1.19290 WP_003430158.1.1934 WP_003430158.1.19627 WP_003430158.1.19648 WP_003430158.1.19704 WP_003430158.1.19899 WP_003430158.1.19956 WP_003430158.1.1999 WP_003430158.1.2002 WP_003430158.1.20132 WP_003430158.1.20184 WP_003430158.1.20302 WP_003430158.1.20313 WP_003430158.1.20481 WP_003430158.1.20650 WP_003430158.1.20728 WP_003430158.1.20872 WP_003430158.1.20875 WP_003430158.1.20960 WP_003430158.1.21000 WP_003430158.1.21048 WP_003430158.1.21201 WP_003430158.1.21220 WP_003430158.1.21417 WP_003430158.1.21502 WP_003430158.1.21520 WP_003430158.1.21547 WP_003430158.1.21618 WP_003430158.1.21704 WP_003430158.1.21893 WP_003430158.1.22020 WP_003430158.1.22079 WP_003430158.1.22128 WP_003430158.1.22222 WP_003430158.1.22228 WP_003430158.1.22313 WP_003430158.1.22357 WP_003430158.1.22411 WP_003430158.1.22417 WP_003430158.1.22568 WP_003430158.1.22569 WP_003430158.1.22615 WP_003430158.1.22768 WP_003430158.1.22893 WP_003430158.1.22937 WP_003430158.1.23096 WP_003430158.1.23208 WP_003430158.1.23287 WP_003430158.1.23338 WP_003430158.1.2363 WP_003430158.1.24197 WP_003430158.1.24457 WP_003430158.1.24520 WP_003430158.1.24826 WP_003430158.1.24889 WP_003430158.1.24900 WP_003430158.1.24987 WP_003430158.1.25128 WP_003430158.1.25416 WP_003430158.1.25761 WP_003430158.1.26024 WP_003430158.1.26044 WP_003430158.1.26358 WP_003430158.1.26482 WP_003430158.1.26494 WP_003430158.1.26697 WP_003430158.1.26829 WP_003430158.1.26940 WP_003430158.1.27563 WP_003430158.1.2758 WP_003430158.1.27677 WP_003430158.1.27708 WP_003430158.1.27824 WP_003430158.1.27872 WP_003430158.1.27881 WP_003430158.1.27890 WP_003430158.1.27967 WP_003430158.1.27989 WP_003430158.1.27996 WP_003430158.1.28055 WP_003430158.1.28410 WP_003430158.1.28638 WP_003430158.1.28715 WP_003430158.1.28856 WP_003430158.1.28882 WP_003430158.1.28890 WP_003430158.1.28930 WP_003430158.1.2923 WP_003430158.1.293 WP_003430158.1.29600 WP_003430158.1.29757 WP_003430158.1.2982 WP_003430158.1.29891 WP_003430158.1.3024 WP_003430158.1.303 WP_003430158.1.3031 WP_003430158.1.30420 WP_003430158.1.30431 WP_003430158.1.30463 WP_003430158.1.30519 WP_003430158.1.30521 WP_003430158.1.30743 WP_003430158.1.30841 WP_003430158.1.30953 WP_003430158.1.31160 WP_003430158.1.31183 WP_003430158.1.31203 WP_003430158.1.31292 WP_003430158.1.31309 WP_003430158.1.31351 WP_003430158.1.31385 WP_003430158.1.31453 WP_003430158.1.31475 WP_003430158.1.31477 WP_003430158.1.31519 WP_003430158.1.31637 WP_003430158.1.31719 WP_003430158.1.31742 WP_003430158.1.31960 WP_003430158.1.31969 WP_003430158.1.32008 WP_003430158.1.32066 WP_003430158.1.32119 WP_003430158.1.32166 WP_003430158.1.32197 WP_003430158.1.32218 WP_003430158.1.32230 WP_003430158.1.32294 WP_003430158.1.32699 WP_003430158.1.32769 WP_003430158.1.32776 WP_003430158.1.32842 WP_003430158.1.33056 WP_003430158.1.33098 WP_003430158.1.33164 WP_003430158.1.33298 WP_003430158.1.33332 WP_003430158.1.33349 WP_003430158.1.3340 WP_003430158.1.33514 WP_003430158.1.33810 WP_003430158.1.34388 WP_003430158.1.34489 WP_003430158.1.34545 WP_003430158.1.34641 WP_003430158.1.34800 WP_003430158.1.34985 WP_003430158.1.34989 WP_003430158.1.35 WP_003430158.1.35002 WP_003430158.1.35137 WP_003430158.1.35181 WP_003430158.1.35187 WP_003430158.1.35234 WP_003430158.1.3559 WP_003430158.1.35709 WP_003430158.1.35832 WP_003430158.1.35884 WP_003430158.1.36078 WP_003430158.1.36257 WP_003430158.1.36338 WP_003430158.1.36738 WP_003430158.1.36835 WP_003430158.1.37255 WP_003430158.1.374 WP_003430158.1.37493 WP_003430158.1.37532 WP_003430158.1.37597 WP_003430158.1.37861 WP_003430158.1.3789 WP_003430158.1.37957 WP_003430158.1.37981 WP_003430158.1.38305 WP_003430158.1.38338 WP_003430158.1.38692 WP_003430158.1.38775 WP_003430158.1.38814 WP_003430158.1.38874 WP_003430158.1.38924 WP_003430158.1.38986 WP_003430158.1.39008 WP_003430158.1.3913 WP_003430158.1.39213 WP_003430158.1.39350 WP_003430158.1.39382 WP_003430158.1.39442 WP_003430158.1.39525 WP_003430158.1.39621 WP_003430158.1.39783 WP_003430158.1.39874 WP_003430158.1.39876 WP_003430158.1.39975 WP_003430158.1.39981 WP_003430158.1.40030 WP_003430158.1.40294 WP_003430158.1.40313 WP_003430158.1.40447 WP_003430158.1.40522 WP_003430158.1.40557 WP_003430158.1.407 WP_003430158.1.40775 WP_003430158.1.40891 WP_003430158.1.40959 WP_003430158.1.40966 WP_003430158.1.41131 WP_003430158.1.4121 WP_003430158.1.41334 WP_003430158.1.41342 WP_003430158.1.4137 WP_003430158.1.41506 WP_003430158.1.41534 WP_003430158.1.41641 WP_003430158.1.41687 WP_003430158.1.41818 WP_003430158.1.41995 WP_003430158.1.42035 WP_003430158.1.4204 WP_003430158.1.42066 WP_003430158.1.42532 WP_003430158.1.42533 WP_003430158.1.42610 WP_003430158.1.42664 WP_003430158.1.43112 WP_003430158.1.4315 WP_003430158.1.4321 WP_003430158.1.43388 WP_003430158.1.43490 WP_003430158.1.43519 WP_003430158.1.43579 WP_003430158.1.43663 WP_003430158.1.43824 WP_003430158.1.4383 WP_003430158.1.44030 WP_003430158.1.44105 WP_003430158.1.44149 WP_003430158.1.44198 WP_003430158.1.44241 WP_003430158.1.44470 WP_003430158.1.44471 WP_003430158.1.44729 WP_003430158.1.45017 WP_003430158.1.45059 WP_003430158.1.45142 WP_003430158.1.45165 WP_003430158.1.45209 WP_003430158.1.45257 WP_003430158.1.45352 WP_003430158.1.45554 WP_003430158.1.4573 WP_003430158.1.45938 WP_003430158.1.45986 WP_003430158.1.46066 WP_003430158.1.46274 WP_003430158.1.46280 WP_003430158.1.46305 WP_003430158.1.46522 WP_003430158.1.4698 WP_003430158.1.47016 WP_003430158.1.47121 WP_003430158.1.47173 WP_003430158.1.47227 WP_003430158.1.47228 WP_003430158.1.47479 WP_003430158.1.47615 WP_003430158.1.47708 WP_003430158.1.47729 WP_003430158.1.47940 WP_003430158.1.48220 WP_003430158.1.48246 WP_003430158.1.48279 WP_003430158.1.4835 WP_003430158.1.48733 WP_003430158.1.48746 WP_003430158.1.48772 WP_003430158.1.48935 WP_003430158.1.48980 WP_003430158.1.48983 WP_003430158.1.48991 WP_003430158.1.49020 WP_003430158.1.49054 WP_003430158.1.49065 WP_003430158.1.4908 WP_003430158.1.49092 WP_003430158.1.49230 WP_003430158.1.49310 WP_003430158.1.49339 WP_003430158.1.4948 WP_003430158.1.49633 WP_003430158.1.50159 WP_003430158.1.50341 WP_003430158.1.50460 WP_003430158.1.5073 WP_003430158.1.50865 WP_003430158.1.51007 WP_003430158.1.51235 WP_003430158.1.51675 WP_003430158.1.5187 WP_003430158.1.51996 WP_003430158.1.52073 WP_003430158.1.52266 WP_003430158.1.52278 WP_003430158.1.52294 WP_003430158.1.52311 WP_003430158.1.52330 WP_003430158.1.52383 WP_003430158.1.52402 WP_003430158.1.52466 WP_003430158.1.52525 WP_003430158.1.52789 WP_003430158.1.52958 WP_003430158.1.52997 WP_003430158.1.53008 WP_003430158.1.53044 WP_003430158.1.53055 WP_003430158.1.5337 WP_003430158.1.53504 WP_003430158.1.53704 WP_003430158.1.53710 WP_003430158.1.53729 WP_003430158.1.53987 WP_003430158.1.54058 WP_003430158.1.54153 WP_003430158.1.5423 WP_003430158.1.54262 WP_003430158.1.54350 WP_003430158.1.54586 WP_003430158.1.54593 WP_003430158.1.54692 WP_003430158.1.55055 WP_003430158.1.55101 WP_003430158.1.5521 WP_003430158.1.55302 WP_003430158.1.55371 WP_003430158.1.55391 WP_003430158.1.5558 WP_003430158.1.559 WP_003430158.1.56006 WP_003430158.1.56217 WP_003430158.1.56252 WP_003430158.1.56323 WP_003430158.1.56337 WP_003430158.1.56556 WP_003430158.1.5657 WP_003430158.1.5661 WP_003430158.1.5664 WP_003430158.1.56664 WP_003430158.1.56711 WP_003430158.1.56754 WP_003430158.1.56927 WP_003430158.1.56998 WP_003430158.1.57099 WP_003430158.1.57337 WP_003430158.1.5750 WP_003430158.1.57711 WP_003430158.1.57827 WP_003430158.1.58015 WP_003430158.1.58216 WP_003430158.1.58304 WP_003430158.1.58315 WP_003430158.1.58323 WP_003430158.1.58463 WP_003430158.1.58531 WP_003430158.1.58665 WP_003430158.1.58677 WP_003430158.1.58711 WP_003430158.1.58818 WP_003430158.1.58956 WP_003430158.1.59032 WP_003430158.1.5905 WP_003430158.1.59588 WP_003430158.1.59618 WP_003430158.1.59628 WP_003430158.1.59707 WP_003430158.1.59752 WP_003430158.1.59990 WP_003430158.1.60040 WP_003430158.1.6031 WP_003430158.1.60482 WP_003430158.1.60563 WP_003430158.1.6070 WP_003430158.1.60957 WP_003430158.1.60998 WP_003430158.1.61140 WP_003430158.1.61293 WP_003430158.1.61492 WP_003430158.1.61679 WP_003430158.1.61716 WP_003430158.1.61866 WP_003430158.1.61972 WP_003430158.1.62049 WP_003430158.1.62095 WP_003430158.1.62128 WP_003430158.1.62340 WP_003430158.1.62577 WP_003430158.1.62624 WP_003430158.1.62637 WP_003430158.1.62941 WP_003430158.1.62986 WP_003430158.1.63020 WP_003430158.1.63059 WP_003430158.1.63237 WP_003430158.1.63239 WP_003430158.1.63248 WP_003430158.1.63343 WP_003430158.1.63378 WP_003430158.1.63516 WP_003430158.1.63570 WP_003430158.1.63581 WP_003430158.1.63598 WP_003430158.1.63599 WP_003430158.1.63696 WP_003430158.1.63804 WP_003430158.1.63853 WP_003430158.1.63950 WP_003430158.1.64020 WP_003430158.1.64092 WP_003430158.1.64197 WP_003430158.1.64369 WP_003430158.1.64447 WP_003430158.1.64546 WP_003430158.1.64573 WP_003430158.1.64859 WP_003430158.1.65064 WP_003430158.1.65067 WP_003430158.1.65313 WP_003430158.1.65369 WP_003430158.1.65889 WP_003430158.1.66084 WP_003430158.1.66119 WP_003430158.1.66237 WP_003430158.1.66439 WP_003430158.1.66474 WP_003430158.1.66565 WP_003430158.1.66587 WP_003430158.1.66608 WP_003430158.1.66643 WP_003430158.1.66701 WP_003430158.1.6671 WP_003430158.1.6675 WP_003430158.1.66805 WP_003430158.1.66847 WP_003430158.1.6685 WP_003430158.1.66887 WP_003430158.1.66888 WP_003430158.1.66900 WP_003430158.1.670 WP_003430158.1.67303 WP_003430158.1.67308 WP_003430158.1.6736 WP_003430158.1.67368 WP_003430158.1.67528 WP_003430158.1.67689 WP_003430158.1.67695 WP_003430158.1.67711 WP_003430158.1.6792 WP_003430158.1.67951 WP_003430158.1.68150 WP_003430158.1.68276 WP_003430158.1.68322 WP_003430158.1.68955 WP_003430158.1.6898 WP_003430158.1.68980 WP_003430158.1.69114 WP_003430158.1.692 WP_003430158.1.69220 WP_003430158.1.69333 WP_003430158.1.69495 WP_003430158.1.69708 WP_003430158.1.6994 WP_003430158.1.700 WP_003430158.1.70152 WP_003430158.1.70179 WP_003430158.1.70231 WP_003430158.1.70320 WP_003430158.1.70695 WP_003430158.1.70710 WP_003430158.1.70820 WP_003430158.1.70886 WP_003430158.1.71079 WP_003430158.1.71119 WP_003430158.1.713 WP_003430158.1.71384 WP_003430158.1.71477 WP_003430158.1.7156 WP_003430158.1.71745 WP_003430158.1.7199 WP_003430158.1.72113 WP_003430158.1.72245 WP_003430158.1.72468 WP_003430158.1.72483 WP_003430158.1.72560 WP_003430158.1.72681 WP_003430158.1.72682 WP_003430158.1.72891 WP_003430158.1.72909 WP_003430158.1.72914 WP_003430158.1.72994 WP_003430158.1.73026 WP_003430158.1.73116 WP_003430158.1.7322 WP_003430158.1.73605 WP_003430158.1.73836 WP_003430158.1.73852 WP_003430158.1.73931 WP_003430158.1.74050 WP_003430158.1.74116 WP_003430158.1.74126 WP_003430158.1.74672 WP_003430158.1.74678 WP_003430158.1.74680 WP_003430158.1.74779 WP_003430158.1.74835 WP_003430158.1.74897 WP_003430158.1.75026 WP_003430158.1.751 WP_003430158.1.75210 WP_003430158.1.75226 WP_003430158.1.75287 WP_003430158.1.75454 WP_003430158.1.75638 WP_003430158.1.75659 WP_003430158.1.76207 WP_003430158.1.7650 WP_003430158.1.76550 WP_003430158.1.76552 WP_003430158.1.76603 WP_003430158.1.76621 WP_003430158.1.76664 WP_003430158.1.76687 WP_003430158.1.76793 WP_003430158.1.76813 WP_003430158.1.76882 WP_003430158.1.76924 WP_003430158.1.7696 WP_003430158.1.77092 WP_003430158.1.77102 WP_003430158.1.77473 WP_003430158.1.77509 WP_003430158.1.77544 WP_003430158.1.7755 WP_003430158.1.77639 WP_003430158.1.77782 WP_003430158.1.77842 WP_003430158.1.77942 WP_003430158.1.78123 WP_003430158.1.78579 WP_003430158.1.78949 WP_003430158.1.7916 WP_003430158.1.79199 WP_003430158.1.79221 WP_003430158.1.79309 WP_003430158.1.79344 WP_003430158.1.79437 WP_003430158.1.79611 WP_003430158.1.79680 WP_003430158.1.79703 WP_003430158.1.79836 WP_003430158.1.79956 WP_003430158.1.80052 WP_003430158.1.80144 WP_003430158.1.80342 WP_003430158.1.80379 WP_003430158.1.80455 WP_003430158.1.80504 WP_003430158.1.80575 WP_003430158.1.80963 WP_003430158.1.81035 WP_003430158.1.81044 WP_003430158.1.81208 WP_003430158.1.81299 WP_003430158.1.81351 WP_003430158.1.81402 WP_003430158.1.81605 WP_003430158.1.81777 WP_003430158.1.82002 WP_003430158.1.82084 WP_003430158.1.82150 WP_003430158.1.82169 WP_003430158.1.82335 WP_003430158.1.82635 WP_003430158.1.82701 WP_003430158.1.82920 WP_003430158.1.8314 WP_003430158.1.83148 WP_003430158.1.83175 WP_003430158.1.83255 WP_003430158.1.83287 WP_003430158.1.83288 WP_003430158.1.83318 WP_003430158.1.83348 WP_003430158.1.8336 WP_003430158.1.834 WP_003430158.1.83477 WP_003430158.1.83515 WP_003430158.1.83822 WP_003430158.1.83918 WP_003430158.1.84253 WP_003430158.1.84528 WP_003430158.1.84646 WP_003430158.1.84843 WP_003430158.1.84880 WP_003430158.1.84923 WP_003430158.1.85020 WP_003430158.1.85127 WP_003430158.1.85214 WP_003430158.1.85219 WP_003430158.1.8527 WP_003430158.1.85420 WP_003430158.1.85442 WP_003430158.1.85454 WP_003430158.1.85776 WP_003430158.1.85863 WP_003430158.1.8587 WP_003430158.1.85874 WP_003430158.1.85932 WP_003430158.1.86008 WP_003430158.1.86011 WP_003430158.1.86049 WP_003430158.1.86088 WP_003430158.1.86094 WP_003430158.1.86116 WP_003430158.1.86117 WP_003430158.1.86328 WP_003430158.1.86395 WP_003430158.1.86534 WP_003430158.1.86618 WP_003430158.1.86743 WP_003430158.1.86767 WP_003430158.1.86837 WP_003430158.1.86914 WP_003430158.1.87058 WP_003430158.1.87195 WP_003430158.1.87326 WP_003430158.1.87454 WP_003430158.1.87714 WP_003430158.1.87723 WP_003430158.1.87730 WP_003430158.1.87918 WP_003430158.1.87932 WP_003430158.1.88091 WP_003430158.1.882 WP_003430158.1.88268 WP_003430158.1.88332 WP_003430158.1.88364 WP_003430158.1.88372 WP_003430158.1.88377 WP_003430158.1.88608 WP_003430158.1.88640 WP_003430158.1.88996 WP_003430158.1.89052 WP_003430158.1.89065 WP_003430158.1.89196 WP_003430158.1.89337 WP_003430158.1.89364 WP_003430158.1.89457 WP_003430158.1.89541 WP_003430158.1.89629 WP_003430158.1.89697 WP_003430158.1.8984 WP_003430158.1.89994 WP_003430158.1.90076 WP_003430158.1.90101 WP_003430158.1.90164 WP_003430158.1.90329 WP_003430158.1.9041 WP_003430158.1.90491 WP_003430158.1.90555 WP_003430158.1.90643 WP_003430158.1.9083 WP_003430158.1.90921 WP_003430158.1.90938 WP_003430158.1.90981 WP_003430158.1.90985 WP_003430158.1.91065 WP_003430158.1.91254 WP_003430158.1.91314 WP_003430158.1.91406 WP_003430158.1.91570 WP_003430158.1.91648 WP_003430158.1.92075 WP_003430158.1.92284 WP_003430158.1.92371 WP_003430158.1.92576 WP_003430158.1.92658 WP_003430158.1.92697 WP_003430158.1.92941 WP_003430158.1.93044 WP_003430158.1.93171 WP_003430158.1.93313 WP_003430158.1.93360 WP_003430158.1.93480 WP_003430158.1.93615 WP_003430158.1.93687 WP_003430158.1.93717 WP_003430158.1.93766 WP_003430158.1.93782 WP_003430158.1.93798 WP_003430158.1.93802 WP_003430158.1.93830 WP_003430158.1.9393 WP_003430158.1.93968 WP_003430158.1.94067 WP_003430158.1.94073 WP_003430158.1.94166 WP_003430158.1.94427 WP_003430158.1.94768 WP_003430158.1.94831 WP_003430158.1.94968 WP_003430158.1.95095 WP_003430158.1.95173 WP_003430158.1.9522 WP_003430158.1.95350 WP_003430158.1.95517 WP_003430158.1.9580 WP_003430158.1.95847 WP_003430158.1.95893 WP_003430158.1.9635 WP_003430158.1.96503 WP_003430158.1.96505 WP_003430158.1.9666 WP_003430158.1.96690 WP_003430158.1.96765 WP_003430158.1.97219 WP_003430158.1.97458 WP_003430158.1.97672 WP_003430158.1.97682 WP_003430158.1.97806 WP_003430158.1.98037 WP_003430158.1.98514 WP_003430158.1.98622 WP_003430158.1.98698 WP_003430158.1.98715 WP_003430158.1.98748 WP_003430158.1.98856 WP_003430158.1.98913 WP_003430158.1.98997 WP_003430158.1.99064 WP_003430158.1.99134 WP_003430158.1.99333 WP_003430158.1.99542 WP_003430158.1.99545 WP_003430158.1.99731 WP_003430158.1.9986 YP_001088195.1.32744 gi|126699298|ref|YP_001088195.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]