SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260683598|ref|YP_003214883.1| from Clostridium difficile CD196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260683598|ref|YP_003214883.1|
Domain Number 1 Region: 18-117
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.09e-28
Family HxlR-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|260683598|ref|YP_003214883.1|
Sequence length 118
Comment transcriptional regulator [Clostridium difficile CD196]
Sequence
MDIDNNFEEFPNIEERQKDFNCSIGFTMTVIGSKWRAIILWHILKQEPIRYSQLKKDVVH
ISHKILSQELKYLERDGLIKRISYPTIPPKVEYLSTKRGKSLESILLELCNWGKQYMR
Download sequence
Identical sequences A0A0H3N417 A0A1F2D5F0 C9YMU6
gi|260683598|ref|YP_003214883.1| gi|384361220|ref|YP_006199072.1| 645462.CD196_1862 645463.CDR20291_1905 WP_009889955.1.100097 WP_009889955.1.100139 WP_009889955.1.10130 WP_009889955.1.10488 WP_009889955.1.11025 WP_009889955.1.12169 WP_009889955.1.1273 WP_009889955.1.12809 WP_009889955.1.13040 WP_009889955.1.13251 WP_009889955.1.13398 WP_009889955.1.14170 WP_009889955.1.14205 WP_009889955.1.1445 WP_009889955.1.14483 WP_009889955.1.14674 WP_009889955.1.15310 WP_009889955.1.16520 WP_009889955.1.16728 WP_009889955.1.16931 WP_009889955.1.17638 WP_009889955.1.17879 WP_009889955.1.17908 WP_009889955.1.18212 WP_009889955.1.18298 WP_009889955.1.18455 WP_009889955.1.18680 WP_009889955.1.19152 WP_009889955.1.19899 WP_009889955.1.20650 WP_009889955.1.20875 WP_009889955.1.21220 WP_009889955.1.21618 WP_009889955.1.22020 WP_009889955.1.22222 WP_009889955.1.22937 WP_009889955.1.2363 WP_009889955.1.26829 WP_009889955.1.2758 WP_009889955.1.27677 WP_009889955.1.27989 WP_009889955.1.2923 WP_009889955.1.2982 WP_009889955.1.303 WP_009889955.1.30519 WP_009889955.1.31160 WP_009889955.1.31183 WP_009889955.1.31351 WP_009889955.1.31385 WP_009889955.1.31475 WP_009889955.1.31742 WP_009889955.1.31960 WP_009889955.1.32119 WP_009889955.1.32230 WP_009889955.1.32699 WP_009889955.1.35181 WP_009889955.1.36338 WP_009889955.1.39525 WP_009889955.1.39876 WP_009889955.1.39975 WP_009889955.1.39981 WP_009889955.1.40522 WP_009889955.1.41342 WP_009889955.1.41534 WP_009889955.1.42664 WP_009889955.1.44471 WP_009889955.1.45165 WP_009889955.1.45257 WP_009889955.1.46066 WP_009889955.1.46522 WP_009889955.1.47121 WP_009889955.1.48279 WP_009889955.1.48935 WP_009889955.1.49339 WP_009889955.1.53044 WP_009889955.1.53704 WP_009889955.1.53710 WP_009889955.1.53729 WP_009889955.1.5423 WP_009889955.1.54262 WP_009889955.1.54692 WP_009889955.1.56217 WP_009889955.1.57711 WP_009889955.1.57827 WP_009889955.1.58323 WP_009889955.1.59588 WP_009889955.1.59707 WP_009889955.1.61492 WP_009889955.1.61679 WP_009889955.1.61972 WP_009889955.1.62637 WP_009889955.1.63248 WP_009889955.1.63581 WP_009889955.1.63599 WP_009889955.1.63853 WP_009889955.1.64197 WP_009889955.1.64447 WP_009889955.1.66119 WP_009889955.1.6675 WP_009889955.1.66888 WP_009889955.1.66900 WP_009889955.1.670 WP_009889955.1.6736 WP_009889955.1.67528 WP_009889955.1.67695 WP_009889955.1.68955 WP_009889955.1.6898 WP_009889955.1.69495 WP_009889955.1.700 WP_009889955.1.70152 WP_009889955.1.71745 WP_009889955.1.72682 WP_009889955.1.72909 WP_009889955.1.7322 WP_009889955.1.73931 WP_009889955.1.74116 WP_009889955.1.74680 WP_009889955.1.751 WP_009889955.1.7650 WP_009889955.1.76687 WP_009889955.1.76813 WP_009889955.1.7755 WP_009889955.1.77782 WP_009889955.1.79199 WP_009889955.1.79611 WP_009889955.1.81208 WP_009889955.1.82335 WP_009889955.1.83515 WP_009889955.1.84843 WP_009889955.1.84880 WP_009889955.1.8527 WP_009889955.1.86328 WP_009889955.1.86395 WP_009889955.1.86534 WP_009889955.1.87058 WP_009889955.1.87454 WP_009889955.1.87730 WP_009889955.1.87932 WP_009889955.1.88372 WP_009889955.1.88377 WP_009889955.1.89337 WP_009889955.1.90076 WP_009889955.1.9041 WP_009889955.1.91065 WP_009889955.1.91406 WP_009889955.1.92658 WP_009889955.1.92941 WP_009889955.1.93360 WP_009889955.1.9522 WP_009889955.1.9580 WP_009889955.1.96765 WP_009889955.1.98622 WP_009889955.1.98748 WP_009889955.1.99731 gi|260687258|ref|YP_003218392.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]