SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260683613|ref|YP_003214898.1| from Clostridium difficile CD196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260683613|ref|YP_003214898.1|
Domain Number 1 Region: 5-86
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.51e-23
Family Hypothetical protein PH1932 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|260683613|ref|YP_003214898.1|
Sequence length 99
Comment ArsR family transcriptional regulator [Clostridium difficile CD196]
Sequence
MVLGFPETFKALSDPIRREILVMLRENKMSAGEISEKFNMTNATISYHLSQLKKAGLIFE
TKYKNFIFYEINISVFEEVMLWFSQFMEKGEKDNEKSDK
Download sequence
Identical sequences A0A0H3N458 C9YMW1 D5RZR7 G6B8X4 G6BKI7
gi|260683613|ref|YP_003214898.1| 272563.CD1994A 645462.CD196_1877 645463.CDR20291_1920 gi|260687273|ref|YP_003218407.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]