SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260683665|ref|YP_003214950.1| from Clostridium difficile CD196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260683665|ref|YP_003214950.1|
Domain Number 1 Region: 4-123
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.53e-26
Family Penicillinase repressor 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|260683665|ref|YP_003214950.1|
Sequence length 125
Comment regulatory protein [Clostridium difficile CD196]
Sequence
MTITKIPPAELKVMKFIWSSDFTVASKDVIEAMEKLYNWKQTTTLTLLSRLVNKQFLSAR
KIDRHTHYTVLIGEEEYLHFETKTFLDNMHGSSIESFMKSLFKKGVNEEELNSVEKWVKD
IKKDE
Download sequence
Identical sequences A0A031WI39 A0A0H3N867 A0A125V6K0 A0A1F2CUW2 C9YN13 G6B932 G6BKC8 Q188D5 T4APY0 T4HMZ1 U3VA25
gi|260687325|ref|YP_003218459.1| gi|126699682|ref|YP_001088579.1| 388128 gi|260683665|ref|YP_003214950.1| WP_003428999.1.100055 WP_003428999.1.100097 WP_003428999.1.100099 WP_003428999.1.100107 WP_003428999.1.100118 WP_003428999.1.100139 WP_003428999.1.100513 WP_003428999.1.100570 WP_003428999.1.100660 WP_003428999.1.100831 WP_003428999.1.100923 WP_003428999.1.100977 WP_003428999.1.101035 WP_003428999.1.101125 WP_003428999.1.101279 WP_003428999.1.10130 WP_003428999.1.101316 WP_003428999.1.101532 WP_003428999.1.101861 WP_003428999.1.101929 WP_003428999.1.102031 WP_003428999.1.102074 WP_003428999.1.102095 WP_003428999.1.10483 WP_003428999.1.10488 WP_003428999.1.10582 WP_003428999.1.10691 WP_003428999.1.10793 WP_003428999.1.10795 WP_003428999.1.11025 WP_003428999.1.11224 WP_003428999.1.11278 WP_003428999.1.11320 WP_003428999.1.11398 WP_003428999.1.1167 WP_003428999.1.1179 WP_003428999.1.11937 WP_003428999.1.11954 WP_003428999.1.11959 WP_003428999.1.12066 WP_003428999.1.12169 WP_003428999.1.12385 WP_003428999.1.1254 WP_003428999.1.12629 WP_003428999.1.12632 WP_003428999.1.12659 WP_003428999.1.1273 WP_003428999.1.12734 WP_003428999.1.12807 WP_003428999.1.12809 WP_003428999.1.12953 WP_003428999.1.13040 WP_003428999.1.13251 WP_003428999.1.13273 WP_003428999.1.13398 WP_003428999.1.13418 WP_003428999.1.13730 WP_003428999.1.13823 WP_003428999.1.13841 WP_003428999.1.13859 WP_003428999.1.14045 WP_003428999.1.141 WP_003428999.1.14170 WP_003428999.1.14177 WP_003428999.1.14205 WP_003428999.1.1422 WP_003428999.1.14259 WP_003428999.1.14330 WP_003428999.1.14352 WP_003428999.1.1445 WP_003428999.1.14457 WP_003428999.1.14483 WP_003428999.1.14579 WP_003428999.1.14674 WP_003428999.1.14686 WP_003428999.1.14698 WP_003428999.1.14848 WP_003428999.1.1494 WP_003428999.1.15083 WP_003428999.1.15097 WP_003428999.1.15192 WP_003428999.1.15205 WP_003428999.1.15310 WP_003428999.1.15435 WP_003428999.1.15908 WP_003428999.1.16012 WP_003428999.1.16135 WP_003428999.1.16185 WP_003428999.1.16190 WP_003428999.1.16376 WP_003428999.1.16520 WP_003428999.1.16728 WP_003428999.1.16897 WP_003428999.1.169 WP_003428999.1.16931 WP_003428999.1.16966 WP_003428999.1.1705 WP_003428999.1.17371 WP_003428999.1.17413 WP_003428999.1.17463 WP_003428999.1.17512 WP_003428999.1.17611 WP_003428999.1.17638 WP_003428999.1.17808 WP_003428999.1.17851 WP_003428999.1.17879 WP_003428999.1.17908 WP_003428999.1.17960 WP_003428999.1.18060 WP_003428999.1.18207 WP_003428999.1.18212 WP_003428999.1.18298 WP_003428999.1.1838 WP_003428999.1.18407 WP_003428999.1.18455 WP_003428999.1.18462 WP_003428999.1.18551 WP_003428999.1.18680 WP_003428999.1.18805 WP_003428999.1.18970 WP_003428999.1.19152 WP_003428999.1.1926 WP_003428999.1.19290 WP_003428999.1.1934 WP_003428999.1.19627 WP_003428999.1.19648 WP_003428999.1.19704 WP_003428999.1.19899 WP_003428999.1.19956 WP_003428999.1.1999 WP_003428999.1.2002 WP_003428999.1.20132 WP_003428999.1.20184 WP_003428999.1.20302 WP_003428999.1.20313 WP_003428999.1.20481 WP_003428999.1.20650 WP_003428999.1.20728 WP_003428999.1.20872 WP_003428999.1.20875 WP_003428999.1.20960 WP_003428999.1.21000 WP_003428999.1.21048 WP_003428999.1.21201 WP_003428999.1.21220 WP_003428999.1.21417 WP_003428999.1.21502 WP_003428999.1.21520 WP_003428999.1.21547 WP_003428999.1.21618 WP_003428999.1.21704 WP_003428999.1.21893 WP_003428999.1.22020 WP_003428999.1.22079 WP_003428999.1.22128 WP_003428999.1.22222 WP_003428999.1.22228 WP_003428999.1.22313 WP_003428999.1.22357 WP_003428999.1.22411 WP_003428999.1.22417 WP_003428999.1.22568 WP_003428999.1.22569 WP_003428999.1.22615 WP_003428999.1.22768 WP_003428999.1.22893 WP_003428999.1.22937 WP_003428999.1.23096 WP_003428999.1.23208 WP_003428999.1.23287 WP_003428999.1.23338 WP_003428999.1.2363 WP_003428999.1.24197 WP_003428999.1.24457 WP_003428999.1.24520 WP_003428999.1.24889 WP_003428999.1.24900 WP_003428999.1.24987 WP_003428999.1.25128 WP_003428999.1.25416 WP_003428999.1.25761 WP_003428999.1.26024 WP_003428999.1.26044 WP_003428999.1.26358 WP_003428999.1.26482 WP_003428999.1.26494 WP_003428999.1.26697 WP_003428999.1.26829 WP_003428999.1.26940 WP_003428999.1.27563 WP_003428999.1.2758 WP_003428999.1.27677 WP_003428999.1.27708 WP_003428999.1.27824 WP_003428999.1.27872 WP_003428999.1.27881 WP_003428999.1.27890 WP_003428999.1.27967 WP_003428999.1.27989 WP_003428999.1.27996 WP_003428999.1.28055 WP_003428999.1.28410 WP_003428999.1.28638 WP_003428999.1.28715 WP_003428999.1.28856 WP_003428999.1.28882 WP_003428999.1.28890 WP_003428999.1.28930 WP_003428999.1.2923 WP_003428999.1.293 WP_003428999.1.29600 WP_003428999.1.29757 WP_003428999.1.2982 WP_003428999.1.29891 WP_003428999.1.3024 WP_003428999.1.303 WP_003428999.1.3031 WP_003428999.1.30420 WP_003428999.1.30431 WP_003428999.1.30463 WP_003428999.1.30519 WP_003428999.1.30521 WP_003428999.1.30743 WP_003428999.1.30841 WP_003428999.1.30953 WP_003428999.1.31160 WP_003428999.1.31183 WP_003428999.1.31203 WP_003428999.1.31292 WP_003428999.1.31309 WP_003428999.1.31351 WP_003428999.1.31385 WP_003428999.1.31453 WP_003428999.1.31475 WP_003428999.1.31477 WP_003428999.1.31519 WP_003428999.1.31637 WP_003428999.1.31719 WP_003428999.1.31742 WP_003428999.1.31960 WP_003428999.1.31969 WP_003428999.1.32008 WP_003428999.1.32066 WP_003428999.1.32119 WP_003428999.1.32166 WP_003428999.1.32197 WP_003428999.1.32218 WP_003428999.1.32230 WP_003428999.1.32294 WP_003428999.1.32699 WP_003428999.1.32769 WP_003428999.1.32776 WP_003428999.1.32842 WP_003428999.1.33056 WP_003428999.1.33098 WP_003428999.1.33164 WP_003428999.1.33298 WP_003428999.1.33332 WP_003428999.1.33349 WP_003428999.1.3340 WP_003428999.1.33514 WP_003428999.1.33810 WP_003428999.1.34388 WP_003428999.1.34489 WP_003428999.1.34545 WP_003428999.1.34641 WP_003428999.1.34800 WP_003428999.1.34985 WP_003428999.1.34989 WP_003428999.1.35 WP_003428999.1.35002 WP_003428999.1.35137 WP_003428999.1.35181 WP_003428999.1.35187 WP_003428999.1.35234 WP_003428999.1.3559 WP_003428999.1.35709 WP_003428999.1.35832 WP_003428999.1.35884 WP_003428999.1.36078 WP_003428999.1.36257 WP_003428999.1.36338 WP_003428999.1.36738 WP_003428999.1.36835 WP_003428999.1.37255 WP_003428999.1.374 WP_003428999.1.37493 WP_003428999.1.37532 WP_003428999.1.37597 WP_003428999.1.37861 WP_003428999.1.3789 WP_003428999.1.37957 WP_003428999.1.37981 WP_003428999.1.38305 WP_003428999.1.38338 WP_003428999.1.38692 WP_003428999.1.38775 WP_003428999.1.38814 WP_003428999.1.38874 WP_003428999.1.38924 WP_003428999.1.38986 WP_003428999.1.39008 WP_003428999.1.3913 WP_003428999.1.39213 WP_003428999.1.39350 WP_003428999.1.39382 WP_003428999.1.39442 WP_003428999.1.39525 WP_003428999.1.39621 WP_003428999.1.39783 WP_003428999.1.39874 WP_003428999.1.39876 WP_003428999.1.39975 WP_003428999.1.39981 WP_003428999.1.40030 WP_003428999.1.40294 WP_003428999.1.40313 WP_003428999.1.40447 WP_003428999.1.40522 WP_003428999.1.40557 WP_003428999.1.407 WP_003428999.1.40775 WP_003428999.1.40891 WP_003428999.1.40959 WP_003428999.1.40966 WP_003428999.1.41131 WP_003428999.1.4121 WP_003428999.1.41334 WP_003428999.1.41342 WP_003428999.1.4137 WP_003428999.1.41506 WP_003428999.1.41534 WP_003428999.1.41641 WP_003428999.1.41687 WP_003428999.1.41818 WP_003428999.1.41995 WP_003428999.1.42035 WP_003428999.1.4204 WP_003428999.1.42066 WP_003428999.1.42532 WP_003428999.1.42533 WP_003428999.1.42610 WP_003428999.1.42664 WP_003428999.1.43112 WP_003428999.1.4315 WP_003428999.1.4321 WP_003428999.1.43388 WP_003428999.1.43490 WP_003428999.1.43519 WP_003428999.1.43579 WP_003428999.1.43663 WP_003428999.1.43824 WP_003428999.1.4383 WP_003428999.1.44030 WP_003428999.1.44105 WP_003428999.1.44149 WP_003428999.1.44198 WP_003428999.1.44241 WP_003428999.1.44470 WP_003428999.1.44471 WP_003428999.1.44729 WP_003428999.1.45017 WP_003428999.1.45059 WP_003428999.1.45142 WP_003428999.1.45165 WP_003428999.1.45209 WP_003428999.1.45257 WP_003428999.1.45352 WP_003428999.1.45554 WP_003428999.1.4573 WP_003428999.1.45938 WP_003428999.1.45986 WP_003428999.1.46066 WP_003428999.1.46274 WP_003428999.1.46280 WP_003428999.1.46305 WP_003428999.1.46522 WP_003428999.1.4698 WP_003428999.1.47016 WP_003428999.1.47121 WP_003428999.1.47173 WP_003428999.1.47227 WP_003428999.1.47228 WP_003428999.1.47479 WP_003428999.1.47615 WP_003428999.1.47708 WP_003428999.1.47729 WP_003428999.1.47940 WP_003428999.1.48220 WP_003428999.1.48246 WP_003428999.1.48279 WP_003428999.1.4835 WP_003428999.1.48746 WP_003428999.1.48772 WP_003428999.1.48935 WP_003428999.1.48980 WP_003428999.1.48983 WP_003428999.1.48991 WP_003428999.1.49020 WP_003428999.1.49054 WP_003428999.1.49065 WP_003428999.1.4908 WP_003428999.1.49092 WP_003428999.1.49230 WP_003428999.1.49310 WP_003428999.1.49339 WP_003428999.1.4948 WP_003428999.1.49633 WP_003428999.1.50159 WP_003428999.1.50341 WP_003428999.1.50460 WP_003428999.1.5073 WP_003428999.1.50865 WP_003428999.1.51007 WP_003428999.1.51235 WP_003428999.1.51675 WP_003428999.1.5187 WP_003428999.1.51996 WP_003428999.1.52073 WP_003428999.1.52266 WP_003428999.1.52278 WP_003428999.1.52311 WP_003428999.1.52330 WP_003428999.1.52383 WP_003428999.1.52402 WP_003428999.1.52466 WP_003428999.1.52525 WP_003428999.1.52789 WP_003428999.1.52958 WP_003428999.1.52997 WP_003428999.1.53008 WP_003428999.1.53044 WP_003428999.1.53055 WP_003428999.1.5337 WP_003428999.1.53504 WP_003428999.1.53704 WP_003428999.1.53710 WP_003428999.1.53729 WP_003428999.1.53987 WP_003428999.1.54058 WP_003428999.1.54153 WP_003428999.1.5423 WP_003428999.1.54262 WP_003428999.1.54350 WP_003428999.1.54586 WP_003428999.1.54593 WP_003428999.1.54692 WP_003428999.1.55055 WP_003428999.1.55101 WP_003428999.1.5521 WP_003428999.1.55302 WP_003428999.1.55371 WP_003428999.1.55391 WP_003428999.1.5558 WP_003428999.1.559 WP_003428999.1.56006 WP_003428999.1.56217 WP_003428999.1.56252 WP_003428999.1.56323 WP_003428999.1.56337 WP_003428999.1.56556 WP_003428999.1.5657 WP_003428999.1.5661 WP_003428999.1.5664 WP_003428999.1.56664 WP_003428999.1.56711 WP_003428999.1.56754 WP_003428999.1.56927 WP_003428999.1.56998 WP_003428999.1.57099 WP_003428999.1.57337 WP_003428999.1.5750 WP_003428999.1.57711 WP_003428999.1.57827 WP_003428999.1.58015 WP_003428999.1.58216 WP_003428999.1.58304 WP_003428999.1.58315 WP_003428999.1.58323 WP_003428999.1.58463 WP_003428999.1.58531 WP_003428999.1.58665 WP_003428999.1.58677 WP_003428999.1.58711 WP_003428999.1.58818 WP_003428999.1.58956 WP_003428999.1.59032 WP_003428999.1.5905 WP_003428999.1.59588 WP_003428999.1.59618 WP_003428999.1.59628 WP_003428999.1.59707 WP_003428999.1.59752 WP_003428999.1.59990 WP_003428999.1.60040 WP_003428999.1.6031 WP_003428999.1.60482 WP_003428999.1.60563 WP_003428999.1.6070 WP_003428999.1.60957 WP_003428999.1.60998 WP_003428999.1.61042 WP_003428999.1.61140 WP_003428999.1.61293 WP_003428999.1.61492 WP_003428999.1.61679 WP_003428999.1.61716 WP_003428999.1.61866 WP_003428999.1.61972 WP_003428999.1.62049 WP_003428999.1.62095 WP_003428999.1.62128 WP_003428999.1.62340 WP_003428999.1.62624 WP_003428999.1.62637 WP_003428999.1.62941 WP_003428999.1.62986 WP_003428999.1.63020 WP_003428999.1.63059 WP_003428999.1.63237 WP_003428999.1.63239 WP_003428999.1.63248 WP_003428999.1.63343 WP_003428999.1.63378 WP_003428999.1.63516 WP_003428999.1.63570 WP_003428999.1.63581 WP_003428999.1.63598 WP_003428999.1.63599 WP_003428999.1.63696 WP_003428999.1.63804 WP_003428999.1.63853 WP_003428999.1.63950 WP_003428999.1.64020 WP_003428999.1.64092 WP_003428999.1.64197 WP_003428999.1.64369 WP_003428999.1.64447 WP_003428999.1.64546 WP_003428999.1.64573 WP_003428999.1.64859 WP_003428999.1.65064 WP_003428999.1.65067 WP_003428999.1.65313 WP_003428999.1.65369 WP_003428999.1.65889 WP_003428999.1.66084 WP_003428999.1.66119 WP_003428999.1.66237 WP_003428999.1.66439 WP_003428999.1.66474 WP_003428999.1.66565 WP_003428999.1.66587 WP_003428999.1.66643 WP_003428999.1.66701 WP_003428999.1.6671 WP_003428999.1.6675 WP_003428999.1.66805 WP_003428999.1.66847 WP_003428999.1.6685 WP_003428999.1.66887 WP_003428999.1.66888 WP_003428999.1.66900 WP_003428999.1.670 WP_003428999.1.67303 WP_003428999.1.67308 WP_003428999.1.6736 WP_003428999.1.67368 WP_003428999.1.67528 WP_003428999.1.67689 WP_003428999.1.67695 WP_003428999.1.67711 WP_003428999.1.6792 WP_003428999.1.67951 WP_003428999.1.68150 WP_003428999.1.68276 WP_003428999.1.68322 WP_003428999.1.68955 WP_003428999.1.6898 WP_003428999.1.68980 WP_003428999.1.69114 WP_003428999.1.692 WP_003428999.1.69220 WP_003428999.1.69333 WP_003428999.1.69708 WP_003428999.1.6994 WP_003428999.1.700 WP_003428999.1.70152 WP_003428999.1.70179 WP_003428999.1.70231 WP_003428999.1.70320 WP_003428999.1.70695 WP_003428999.1.70820 WP_003428999.1.70886 WP_003428999.1.71079 WP_003428999.1.713 WP_003428999.1.71384 WP_003428999.1.7156 WP_003428999.1.71745 WP_003428999.1.7199 WP_003428999.1.72113 WP_003428999.1.72245 WP_003428999.1.72468 WP_003428999.1.72483 WP_003428999.1.72560 WP_003428999.1.72681 WP_003428999.1.72682 WP_003428999.1.72891 WP_003428999.1.72909 WP_003428999.1.72914 WP_003428999.1.72994 WP_003428999.1.73026 WP_003428999.1.73116 WP_003428999.1.7322 WP_003428999.1.73605 WP_003428999.1.73852 WP_003428999.1.73931 WP_003428999.1.74050 WP_003428999.1.74116 WP_003428999.1.74126 WP_003428999.1.74672 WP_003428999.1.74678 WP_003428999.1.74680 WP_003428999.1.74779 WP_003428999.1.74835 WP_003428999.1.74897 WP_003428999.1.75026 WP_003428999.1.751 WP_003428999.1.75210 WP_003428999.1.75226 WP_003428999.1.75287 WP_003428999.1.75454 WP_003428999.1.75638 WP_003428999.1.75659 WP_003428999.1.76207 WP_003428999.1.7650 WP_003428999.1.76550 WP_003428999.1.76552 WP_003428999.1.76603 WP_003428999.1.76621 WP_003428999.1.76664 WP_003428999.1.76687 WP_003428999.1.76793 WP_003428999.1.76813 WP_003428999.1.76882 WP_003428999.1.76924 WP_003428999.1.7696 WP_003428999.1.77092 WP_003428999.1.77102 WP_003428999.1.77473 WP_003428999.1.77509 WP_003428999.1.77544 WP_003428999.1.7755 WP_003428999.1.77639 WP_003428999.1.77782 WP_003428999.1.77842 WP_003428999.1.77942 WP_003428999.1.78123 WP_003428999.1.78579 WP_003428999.1.78949 WP_003428999.1.79125 WP_003428999.1.7916 WP_003428999.1.79199 WP_003428999.1.79221 WP_003428999.1.79309 WP_003428999.1.79344 WP_003428999.1.79437 WP_003428999.1.79611 WP_003428999.1.79673 WP_003428999.1.79680 WP_003428999.1.79703 WP_003428999.1.79836 WP_003428999.1.79956 WP_003428999.1.80052 WP_003428999.1.80144 WP_003428999.1.80342 WP_003428999.1.80379 WP_003428999.1.80455 WP_003428999.1.80504 WP_003428999.1.80575 WP_003428999.1.80963 WP_003428999.1.81035 WP_003428999.1.81044 WP_003428999.1.81208 WP_003428999.1.81299 WP_003428999.1.81351 WP_003428999.1.81402 WP_003428999.1.81777 WP_003428999.1.82002 WP_003428999.1.82084 WP_003428999.1.82150 WP_003428999.1.82169 WP_003428999.1.82335 WP_003428999.1.82635 WP_003428999.1.82701 WP_003428999.1.82920 WP_003428999.1.8314 WP_003428999.1.83148 WP_003428999.1.83175 WP_003428999.1.83255 WP_003428999.1.83287 WP_003428999.1.83288 WP_003428999.1.83318 WP_003428999.1.83348 WP_003428999.1.8336 WP_003428999.1.834 WP_003428999.1.83477 WP_003428999.1.83515 WP_003428999.1.83822 WP_003428999.1.83918 WP_003428999.1.84253 WP_003428999.1.84528 WP_003428999.1.84646 WP_003428999.1.84843 WP_003428999.1.84880 WP_003428999.1.84923 WP_003428999.1.85020 WP_003428999.1.85127 WP_003428999.1.85214 WP_003428999.1.85219 WP_003428999.1.8527 WP_003428999.1.85420 WP_003428999.1.85442 WP_003428999.1.85454 WP_003428999.1.85776 WP_003428999.1.85863 WP_003428999.1.8587 WP_003428999.1.85874 WP_003428999.1.85932 WP_003428999.1.86008 WP_003428999.1.86011 WP_003428999.1.86049 WP_003428999.1.86088 WP_003428999.1.86094 WP_003428999.1.86116 WP_003428999.1.86117 WP_003428999.1.86328 WP_003428999.1.86395 WP_003428999.1.86534 WP_003428999.1.86618 WP_003428999.1.86743 WP_003428999.1.86767 WP_003428999.1.86837 WP_003428999.1.86914 WP_003428999.1.87058 WP_003428999.1.87195 WP_003428999.1.87326 WP_003428999.1.87454 WP_003428999.1.87714 WP_003428999.1.87723 WP_003428999.1.87730 WP_003428999.1.87918 WP_003428999.1.87932 WP_003428999.1.88091 WP_003428999.1.882 WP_003428999.1.88268 WP_003428999.1.88332 WP_003428999.1.88364 WP_003428999.1.88372 WP_003428999.1.88377 WP_003428999.1.88608 WP_003428999.1.88640 WP_003428999.1.88996 WP_003428999.1.89052 WP_003428999.1.89065 WP_003428999.1.89196 WP_003428999.1.89337 WP_003428999.1.89364 WP_003428999.1.89457 WP_003428999.1.89541 WP_003428999.1.89629 WP_003428999.1.89697 WP_003428999.1.8984 WP_003428999.1.89994 WP_003428999.1.90076 WP_003428999.1.90101 WP_003428999.1.90164 WP_003428999.1.90329 WP_003428999.1.9041 WP_003428999.1.90491 WP_003428999.1.90555 WP_003428999.1.90643 WP_003428999.1.9083 WP_003428999.1.90921 WP_003428999.1.90938 WP_003428999.1.90985 WP_003428999.1.91065 WP_003428999.1.91254 WP_003428999.1.91314 WP_003428999.1.91406 WP_003428999.1.91570 WP_003428999.1.91648 WP_003428999.1.92075 WP_003428999.1.92284 WP_003428999.1.92371 WP_003428999.1.92576 WP_003428999.1.92658 WP_003428999.1.92697 WP_003428999.1.92941 WP_003428999.1.93044 WP_003428999.1.93171 WP_003428999.1.93313 WP_003428999.1.93360 WP_003428999.1.93480 WP_003428999.1.93615 WP_003428999.1.93687 WP_003428999.1.93717 WP_003428999.1.93766 WP_003428999.1.93782 WP_003428999.1.93798 WP_003428999.1.93802 WP_003428999.1.93830 WP_003428999.1.9393 WP_003428999.1.93968 WP_003428999.1.94067 WP_003428999.1.94073 WP_003428999.1.94166 WP_003428999.1.94427 WP_003428999.1.94768 WP_003428999.1.94831 WP_003428999.1.94968 WP_003428999.1.95095 WP_003428999.1.95173 WP_003428999.1.9522 WP_003428999.1.95350 WP_003428999.1.95517 WP_003428999.1.9580 WP_003428999.1.95847 WP_003428999.1.95893 WP_003428999.1.96113 WP_003428999.1.9635 WP_003428999.1.96503 WP_003428999.1.96505 WP_003428999.1.9666 WP_003428999.1.96690 WP_003428999.1.96765 WP_003428999.1.97219 WP_003428999.1.97458 WP_003428999.1.97672 WP_003428999.1.97682 WP_003428999.1.97806 WP_003428999.1.98037 WP_003428999.1.98514 WP_003428999.1.98622 WP_003428999.1.98698 WP_003428999.1.98715 WP_003428999.1.98748 WP_003428999.1.98856 WP_003428999.1.98913 WP_003428999.1.98997 WP_003428999.1.99064 WP_003428999.1.99134 WP_003428999.1.99333 WP_003428999.1.99542 WP_003428999.1.99545 WP_003428999.1.99731 WP_003428999.1.9986 YP_001088579.1.32744 272563.CD2065 645462.CD196_1929 645463.CDR20291_1972 gi|384361292|ref|YP_006199144.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]