SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260683808|ref|YP_003215093.1| from Clostridium difficile CD196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260683808|ref|YP_003215093.1|
Domain Number 1 Region: 10-152
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.4e-17
Family MarR-like transcriptional regulators 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|260683808|ref|YP_003215093.1|
Sequence length 165
Comment MarR family transcriptional regulator [Clostridium difficile CD196]
Sequence
MDAESLMKKYMVDDDSRKQAIFASIFVMQNKLQTTCDKLDPELTMKQWLLLAIADSVDET
LTLTKLGELMGCSRQNVKKLAIALEKKGFIQIEQNEKDSRAICLVTKDRVQEYSKKVRGM
QEKVLQLLFEDFTEKEVEQLFFGIMKLSIGIENVKNYVENNDVGE
Download sequence
Identical sequences A0A0H3N4P2 A0A1F2DH02 C9YNF6
gi|260683808|ref|YP_003215093.1| WP_009890383.1.100097 WP_009890383.1.100139 WP_009890383.1.10130 WP_009890383.1.10488 WP_009890383.1.11025 WP_009890383.1.12169 WP_009890383.1.1273 WP_009890383.1.12807 WP_009890383.1.12809 WP_009890383.1.13040 WP_009890383.1.13251 WP_009890383.1.13398 WP_009890383.1.13859 WP_009890383.1.14170 WP_009890383.1.14205 WP_009890383.1.1445 WP_009890383.1.14483 WP_009890383.1.15097 WP_009890383.1.15908 WP_009890383.1.16376 WP_009890383.1.16520 WP_009890383.1.16728 WP_009890383.1.16931 WP_009890383.1.17851 WP_009890383.1.17879 WP_009890383.1.17908 WP_009890383.1.18212 WP_009890383.1.18298 WP_009890383.1.18455 WP_009890383.1.18680 WP_009890383.1.19088 WP_009890383.1.19152 WP_009890383.1.1934 WP_009890383.1.19899 WP_009890383.1.20650 WP_009890383.1.20875 WP_009890383.1.21220 WP_009890383.1.21618 WP_009890383.1.22020 WP_009890383.1.22222 WP_009890383.1.22937 WP_009890383.1.2363 WP_009890383.1.25128 WP_009890383.1.26829 WP_009890383.1.27677 WP_009890383.1.27989 WP_009890383.1.2923 WP_009890383.1.2982 WP_009890383.1.303 WP_009890383.1.30519 WP_009890383.1.31160 WP_009890383.1.31183 WP_009890383.1.31309 WP_009890383.1.31351 WP_009890383.1.31385 WP_009890383.1.31475 WP_009890383.1.31742 WP_009890383.1.31960 WP_009890383.1.32119 WP_009890383.1.32230 WP_009890383.1.32699 WP_009890383.1.34800 WP_009890383.1.34985 WP_009890383.1.35181 WP_009890383.1.3559 WP_009890383.1.36338 WP_009890383.1.37255 WP_009890383.1.38775 WP_009890383.1.39525 WP_009890383.1.39876 WP_009890383.1.39975 WP_009890383.1.39981 WP_009890383.1.40294 WP_009890383.1.40522 WP_009890383.1.41342 WP_009890383.1.41534 WP_009890383.1.42533 WP_009890383.1.42664 WP_009890383.1.43824 WP_009890383.1.44241 WP_009890383.1.44471 WP_009890383.1.44729 WP_009890383.1.45165 WP_009890383.1.45257 WP_009890383.1.46066 WP_009890383.1.46522 WP_009890383.1.4698 WP_009890383.1.47228 WP_009890383.1.48279 WP_009890383.1.48935 WP_009890383.1.49092 WP_009890383.1.51235 WP_009890383.1.51996 WP_009890383.1.53044 WP_009890383.1.5337 WP_009890383.1.53504 WP_009890383.1.53704 WP_009890383.1.53710 WP_009890383.1.53729 WP_009890383.1.5423 WP_009890383.1.54262 WP_009890383.1.54692 WP_009890383.1.55101 WP_009890383.1.55302 WP_009890383.1.55371 WP_009890383.1.56323 WP_009890383.1.56664 WP_009890383.1.56998 WP_009890383.1.57711 WP_009890383.1.57827 WP_009890383.1.58323 WP_009890383.1.59588 WP_009890383.1.59707 WP_009890383.1.60998 WP_009890383.1.61492 WP_009890383.1.61679 WP_009890383.1.61972 WP_009890383.1.62637 WP_009890383.1.63248 WP_009890383.1.63581 WP_009890383.1.63599 WP_009890383.1.63696 WP_009890383.1.63853 WP_009890383.1.64197 WP_009890383.1.64447 WP_009890383.1.66084 WP_009890383.1.66119 WP_009890383.1.66474 WP_009890383.1.6675 WP_009890383.1.66888 WP_009890383.1.66900 WP_009890383.1.670 WP_009890383.1.67308 WP_009890383.1.6736 WP_009890383.1.67528 WP_009890383.1.67695 WP_009890383.1.68955 WP_009890383.1.6898 WP_009890383.1.68980 WP_009890383.1.69495 WP_009890383.1.700 WP_009890383.1.70152 WP_009890383.1.70231 WP_009890383.1.71119 WP_009890383.1.71745 WP_009890383.1.72560 WP_009890383.1.72682 WP_009890383.1.72909 WP_009890383.1.72994 WP_009890383.1.7322 WP_009890383.1.73931 WP_009890383.1.74116 WP_009890383.1.74680 WP_009890383.1.751 WP_009890383.1.7650 WP_009890383.1.76552 WP_009890383.1.76621 WP_009890383.1.76687 WP_009890383.1.76813 WP_009890383.1.7755 WP_009890383.1.77782 WP_009890383.1.79199 WP_009890383.1.79309 WP_009890383.1.79611 WP_009890383.1.80342 WP_009890383.1.80575 WP_009890383.1.80963 WP_009890383.1.81208 WP_009890383.1.81351 WP_009890383.1.82335 WP_009890383.1.83515 WP_009890383.1.83822 WP_009890383.1.84646 WP_009890383.1.84843 WP_009890383.1.84880 WP_009890383.1.8527 WP_009890383.1.85932 WP_009890383.1.86328 WP_009890383.1.86395 WP_009890383.1.86534 WP_009890383.1.87058 WP_009890383.1.87195 WP_009890383.1.87454 WP_009890383.1.87730 WP_009890383.1.87932 WP_009890383.1.88268 WP_009890383.1.88372 WP_009890383.1.88377 WP_009890383.1.89337 WP_009890383.1.89994 WP_009890383.1.90076 WP_009890383.1.90164 WP_009890383.1.9041 WP_009890383.1.91065 WP_009890383.1.91254 WP_009890383.1.91406 WP_009890383.1.92576 WP_009890383.1.92658 WP_009890383.1.92941 WP_009890383.1.93360 WP_009890383.1.94768 WP_009890383.1.9522 WP_009890383.1.96765 WP_009890383.1.98037 WP_009890383.1.98622 WP_009890383.1.98748 WP_009890383.1.99731 gi|384361439|ref|YP_006199291.1| gi|260687468|ref|YP_003218602.1| 645462.CD196_2072 645463.CDR20291_2115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]