SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260683812|ref|YP_003215097.1| from Clostridium difficile CD196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260683812|ref|YP_003215097.1|
Domain Number 1 Region: 7-142
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.85e-32
Family MarR-like transcriptional regulators 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|260683812|ref|YP_003215097.1|
Sequence length 153
Comment MarR family transcriptional regulator [Clostridium difficile CD196]
Sequence
MNSNSEEKLNDVFLQLMRIYFIRTHFYFDKLGLYHGQPQILFSLKMKDGQSQKELADKRK
VKASTTTVMIKRMEKAGLVERKQDEKDQRVSRIFLTDKGLEICNKVEEFNKELEREFFLG
FSEEEKIVLRRLLMQVRDNLKAGCHKHEDEKYF
Download sequence
Identical sequences A0A031WJF6 A0A0H3NCS7 A0A125V7F3 A0A1F2DGZ9 C9YNG0 T4HJ43
gi|384361443|ref|YP_006199295.1| gi|260687472|ref|YP_003218606.1| gi|260683812|ref|YP_003215097.1| WP_003433857.1.100055 WP_003433857.1.100097 WP_003433857.1.100107 WP_003433857.1.100118 WP_003433857.1.100139 WP_003433857.1.100513 WP_003433857.1.100570 WP_003433857.1.100660 WP_003433857.1.100831 WP_003433857.1.100977 WP_003433857.1.101035 WP_003433857.1.101125 WP_003433857.1.10130 WP_003433857.1.101316 WP_003433857.1.101532 WP_003433857.1.101861 WP_003433857.1.102031 WP_003433857.1.102074 WP_003433857.1.102095 WP_003433857.1.10483 WP_003433857.1.10488 WP_003433857.1.10582 WP_003433857.1.10691 WP_003433857.1.10793 WP_003433857.1.10795 WP_003433857.1.11025 WP_003433857.1.11224 WP_003433857.1.11278 WP_003433857.1.11320 WP_003433857.1.11398 WP_003433857.1.1167 WP_003433857.1.11937 WP_003433857.1.11959 WP_003433857.1.12066 WP_003433857.1.12169 WP_003433857.1.12385 WP_003433857.1.1254 WP_003433857.1.12629 WP_003433857.1.12632 WP_003433857.1.12659 WP_003433857.1.1273 WP_003433857.1.12734 WP_003433857.1.12807 WP_003433857.1.12809 WP_003433857.1.13040 WP_003433857.1.13251 WP_003433857.1.13273 WP_003433857.1.13398 WP_003433857.1.13730 WP_003433857.1.13841 WP_003433857.1.13859 WP_003433857.1.141 WP_003433857.1.14170 WP_003433857.1.14177 WP_003433857.1.14205 WP_003433857.1.1422 WP_003433857.1.14259 WP_003433857.1.14330 WP_003433857.1.14352 WP_003433857.1.1445 WP_003433857.1.14483 WP_003433857.1.14579 WP_003433857.1.14674 WP_003433857.1.14686 WP_003433857.1.14698 WP_003433857.1.14848 WP_003433857.1.1494 WP_003433857.1.15083 WP_003433857.1.15097 WP_003433857.1.15192 WP_003433857.1.15205 WP_003433857.1.15310 WP_003433857.1.15908 WP_003433857.1.16012 WP_003433857.1.16135 WP_003433857.1.16185 WP_003433857.1.16190 WP_003433857.1.16376 WP_003433857.1.16520 WP_003433857.1.16728 WP_003433857.1.169 WP_003433857.1.16931 WP_003433857.1.16966 WP_003433857.1.1705 WP_003433857.1.17371 WP_003433857.1.17413 WP_003433857.1.17512 WP_003433857.1.17611 WP_003433857.1.17638 WP_003433857.1.17851 WP_003433857.1.17879 WP_003433857.1.17908 WP_003433857.1.17960 WP_003433857.1.18060 WP_003433857.1.18207 WP_003433857.1.18212 WP_003433857.1.18298 WP_003433857.1.1838 WP_003433857.1.18407 WP_003433857.1.18455 WP_003433857.1.18551 WP_003433857.1.18680 WP_003433857.1.18970 WP_003433857.1.19088 WP_003433857.1.19152 WP_003433857.1.1926 WP_003433857.1.19290 WP_003433857.1.1934 WP_003433857.1.19627 WP_003433857.1.19648 WP_003433857.1.19704 WP_003433857.1.19899 WP_003433857.1.19956 WP_003433857.1.1999 WP_003433857.1.2002 WP_003433857.1.20132 WP_003433857.1.20184 WP_003433857.1.20302 WP_003433857.1.20313 WP_003433857.1.20481 WP_003433857.1.20650 WP_003433857.1.20728 WP_003433857.1.20872 WP_003433857.1.20875 WP_003433857.1.20960 WP_003433857.1.21000 WP_003433857.1.21048 WP_003433857.1.21201 WP_003433857.1.21220 WP_003433857.1.21520 WP_003433857.1.21547 WP_003433857.1.21618 WP_003433857.1.21704 WP_003433857.1.22020 WP_003433857.1.22079 WP_003433857.1.22222 WP_003433857.1.22228 WP_003433857.1.22417 WP_003433857.1.22568 WP_003433857.1.22569 WP_003433857.1.22615 WP_003433857.1.22768 WP_003433857.1.22893 WP_003433857.1.22937 WP_003433857.1.23096 WP_003433857.1.23208 WP_003433857.1.23287 WP_003433857.1.2363 WP_003433857.1.24457 WP_003433857.1.24520 WP_003433857.1.24900 WP_003433857.1.24987 WP_003433857.1.25128 WP_003433857.1.25761 WP_003433857.1.26024 WP_003433857.1.26358 WP_003433857.1.26482 WP_003433857.1.26494 WP_003433857.1.26697 WP_003433857.1.26829 WP_003433857.1.26940 WP_003433857.1.27563 WP_003433857.1.2758 WP_003433857.1.27677 WP_003433857.1.27708 WP_003433857.1.27824 WP_003433857.1.27872 WP_003433857.1.27881 WP_003433857.1.27890 WP_003433857.1.27967 WP_003433857.1.27989 WP_003433857.1.27996 WP_003433857.1.28055 WP_003433857.1.28410 WP_003433857.1.28715 WP_003433857.1.28856 WP_003433857.1.28882 WP_003433857.1.28890 WP_003433857.1.28930 WP_003433857.1.2923 WP_003433857.1.29600 WP_003433857.1.29757 WP_003433857.1.2982 WP_003433857.1.29891 WP_003433857.1.3024 WP_003433857.1.303 WP_003433857.1.3031 WP_003433857.1.30420 WP_003433857.1.30431 WP_003433857.1.30463 WP_003433857.1.30519 WP_003433857.1.30521 WP_003433857.1.30743 WP_003433857.1.30841 WP_003433857.1.30953 WP_003433857.1.31160 WP_003433857.1.31183 WP_003433857.1.31292 WP_003433857.1.31309 WP_003433857.1.31351 WP_003433857.1.31385 WP_003433857.1.31453 WP_003433857.1.31475 WP_003433857.1.31477 WP_003433857.1.31519 WP_003433857.1.31719 WP_003433857.1.31742 WP_003433857.1.31960 WP_003433857.1.32008 WP_003433857.1.32066 WP_003433857.1.32119 WP_003433857.1.32166 WP_003433857.1.32197 WP_003433857.1.32218 WP_003433857.1.32230 WP_003433857.1.32699 WP_003433857.1.32769 WP_003433857.1.32776 WP_003433857.1.32842 WP_003433857.1.33056 WP_003433857.1.33164 WP_003433857.1.33298 WP_003433857.1.33349 WP_003433857.1.3340 WP_003433857.1.33514 WP_003433857.1.33810 WP_003433857.1.34388 WP_003433857.1.34489 WP_003433857.1.34545 WP_003433857.1.34641 WP_003433857.1.34800 WP_003433857.1.34985 WP_003433857.1.35 WP_003433857.1.35002 WP_003433857.1.35137 WP_003433857.1.35181 WP_003433857.1.35187 WP_003433857.1.35234 WP_003433857.1.3559 WP_003433857.1.35709 WP_003433857.1.35832 WP_003433857.1.36078 WP_003433857.1.36257 WP_003433857.1.36338 WP_003433857.1.36738 WP_003433857.1.36835 WP_003433857.1.37255 WP_003433857.1.374 WP_003433857.1.37532 WP_003433857.1.37861 WP_003433857.1.3789 WP_003433857.1.37957 WP_003433857.1.37981 WP_003433857.1.38338 WP_003433857.1.38692 WP_003433857.1.38775 WP_003433857.1.38874 WP_003433857.1.38924 WP_003433857.1.39008 WP_003433857.1.3913 WP_003433857.1.39213 WP_003433857.1.39382 WP_003433857.1.39442 WP_003433857.1.39525 WP_003433857.1.39783 WP_003433857.1.39874 WP_003433857.1.39876 WP_003433857.1.39975 WP_003433857.1.39981 WP_003433857.1.40030 WP_003433857.1.40294 WP_003433857.1.40313 WP_003433857.1.40447 WP_003433857.1.40522 WP_003433857.1.40557 WP_003433857.1.407 WP_003433857.1.40775 WP_003433857.1.40891 WP_003433857.1.40959 WP_003433857.1.40966 WP_003433857.1.41131 WP_003433857.1.4121 WP_003433857.1.41334 WP_003433857.1.41342 WP_003433857.1.41506 WP_003433857.1.41534 WP_003433857.1.41641 WP_003433857.1.41687 WP_003433857.1.41818 WP_003433857.1.41995 WP_003433857.1.42035 WP_003433857.1.4204 WP_003433857.1.42066 WP_003433857.1.42532 WP_003433857.1.42533 WP_003433857.1.42610 WP_003433857.1.42664 WP_003433857.1.43112 WP_003433857.1.4315 WP_003433857.1.4321 WP_003433857.1.43388 WP_003433857.1.43490 WP_003433857.1.43519 WP_003433857.1.43663 WP_003433857.1.43824 WP_003433857.1.4383 WP_003433857.1.44030 WP_003433857.1.44105 WP_003433857.1.44149 WP_003433857.1.44198 WP_003433857.1.44241 WP_003433857.1.44470 WP_003433857.1.44471 WP_003433857.1.44729 WP_003433857.1.45017 WP_003433857.1.45059 WP_003433857.1.45165 WP_003433857.1.45209 WP_003433857.1.45257 WP_003433857.1.45352 WP_003433857.1.45554 WP_003433857.1.4573 WP_003433857.1.45938 WP_003433857.1.45986 WP_003433857.1.46066 WP_003433857.1.46274 WP_003433857.1.46280 WP_003433857.1.46305 WP_003433857.1.46522 WP_003433857.1.4698 WP_003433857.1.47016 WP_003433857.1.47121 WP_003433857.1.47227 WP_003433857.1.47228 WP_003433857.1.47615 WP_003433857.1.47729 WP_003433857.1.47940 WP_003433857.1.48220 WP_003433857.1.48246 WP_003433857.1.48279 WP_003433857.1.4835 WP_003433857.1.48733 WP_003433857.1.48746 WP_003433857.1.48772 WP_003433857.1.48935 WP_003433857.1.48980 WP_003433857.1.48983 WP_003433857.1.48991 WP_003433857.1.49020 WP_003433857.1.49054 WP_003433857.1.4908 WP_003433857.1.49092 WP_003433857.1.49230 WP_003433857.1.49310 WP_003433857.1.49339 WP_003433857.1.4948 WP_003433857.1.49633 WP_003433857.1.50159 WP_003433857.1.5073 WP_003433857.1.50865 WP_003433857.1.51007 WP_003433857.1.51235 WP_003433857.1.51996 WP_003433857.1.52073 WP_003433857.1.52266 WP_003433857.1.52278 WP_003433857.1.52311 WP_003433857.1.52330 WP_003433857.1.52402 WP_003433857.1.52466 WP_003433857.1.52525 WP_003433857.1.52958 WP_003433857.1.52997 WP_003433857.1.53008 WP_003433857.1.53044 WP_003433857.1.53055 WP_003433857.1.5337 WP_003433857.1.53504 WP_003433857.1.53704 WP_003433857.1.53710 WP_003433857.1.53729 WP_003433857.1.54058 WP_003433857.1.54153 WP_003433857.1.5423 WP_003433857.1.54262 WP_003433857.1.54350 WP_003433857.1.54586 WP_003433857.1.54692 WP_003433857.1.55055 WP_003433857.1.55101 WP_003433857.1.5521 WP_003433857.1.55302 WP_003433857.1.55371 WP_003433857.1.55391 WP_003433857.1.5558 WP_003433857.1.559 WP_003433857.1.56006 WP_003433857.1.56217 WP_003433857.1.56252 WP_003433857.1.56323 WP_003433857.1.56337 WP_003433857.1.56556 WP_003433857.1.5657 WP_003433857.1.5661 WP_003433857.1.56664 WP_003433857.1.56711 WP_003433857.1.56754 WP_003433857.1.56927 WP_003433857.1.56998 WP_003433857.1.57337 WP_003433857.1.5750 WP_003433857.1.57711 WP_003433857.1.57827 WP_003433857.1.58216 WP_003433857.1.58315 WP_003433857.1.58665 WP_003433857.1.58677 WP_003433857.1.58711 WP_003433857.1.58818 WP_003433857.1.58956 WP_003433857.1.59032 WP_003433857.1.59628 WP_003433857.1.59707 WP_003433857.1.59752 WP_003433857.1.59990 WP_003433857.1.6031 WP_003433857.1.60482 WP_003433857.1.6070 WP_003433857.1.60957 WP_003433857.1.60998 WP_003433857.1.61140 WP_003433857.1.61293 WP_003433857.1.61492 WP_003433857.1.61679 WP_003433857.1.61716 WP_003433857.1.61866 WP_003433857.1.61972 WP_003433857.1.62049 WP_003433857.1.62095 WP_003433857.1.62340 WP_003433857.1.62577 WP_003433857.1.62624 WP_003433857.1.62637 WP_003433857.1.62941 WP_003433857.1.62986 WP_003433857.1.63020 WP_003433857.1.63059 WP_003433857.1.63239 WP_003433857.1.63248 WP_003433857.1.63343 WP_003433857.1.63378 WP_003433857.1.63516 WP_003433857.1.63581 WP_003433857.1.63598 WP_003433857.1.63599 WP_003433857.1.63696 WP_003433857.1.63804 WP_003433857.1.63853 WP_003433857.1.63950 WP_003433857.1.64020 WP_003433857.1.64092 WP_003433857.1.64197 WP_003433857.1.64369 WP_003433857.1.64447 WP_003433857.1.64546 WP_003433857.1.64573 WP_003433857.1.64859 WP_003433857.1.65064 WP_003433857.1.65067 WP_003433857.1.65313 WP_003433857.1.65369 WP_003433857.1.65889 WP_003433857.1.66084 WP_003433857.1.66119 WP_003433857.1.66237 WP_003433857.1.66439 WP_003433857.1.66474 WP_003433857.1.66565 WP_003433857.1.66587 WP_003433857.1.66643 WP_003433857.1.66701 WP_003433857.1.6671 WP_003433857.1.6675 WP_003433857.1.66805 WP_003433857.1.66847 WP_003433857.1.6685 WP_003433857.1.66887 WP_003433857.1.66888 WP_003433857.1.66900 WP_003433857.1.670 WP_003433857.1.67303 WP_003433857.1.67308 WP_003433857.1.6736 WP_003433857.1.67368 WP_003433857.1.67528 WP_003433857.1.67689 WP_003433857.1.67695 WP_003433857.1.67711 WP_003433857.1.6792 WP_003433857.1.67951 WP_003433857.1.68150 WP_003433857.1.68322 WP_003433857.1.68955 WP_003433857.1.6898 WP_003433857.1.68980 WP_003433857.1.69114 WP_003433857.1.692 WP_003433857.1.69220 WP_003433857.1.69333 WP_003433857.1.69495 WP_003433857.1.69708 WP_003433857.1.6994 WP_003433857.1.700 WP_003433857.1.70152 WP_003433857.1.70179 WP_003433857.1.70231 WP_003433857.1.70320 WP_003433857.1.70695 WP_003433857.1.70710 WP_003433857.1.70820 WP_003433857.1.70886 WP_003433857.1.71079 WP_003433857.1.71119 WP_003433857.1.713 WP_003433857.1.71384 WP_003433857.1.71477 WP_003433857.1.7156 WP_003433857.1.71745 WP_003433857.1.7199 WP_003433857.1.72113 WP_003433857.1.72245 WP_003433857.1.72468 WP_003433857.1.72483 WP_003433857.1.72560 WP_003433857.1.72682 WP_003433857.1.72891 WP_003433857.1.72909 WP_003433857.1.72914 WP_003433857.1.72994 WP_003433857.1.73026 WP_003433857.1.73116 WP_003433857.1.7322 WP_003433857.1.73836 WP_003433857.1.73852 WP_003433857.1.73931 WP_003433857.1.74116 WP_003433857.1.74672 WP_003433857.1.74678 WP_003433857.1.74680 WP_003433857.1.74779 WP_003433857.1.74835 WP_003433857.1.74897 WP_003433857.1.75026 WP_003433857.1.751 WP_003433857.1.75210 WP_003433857.1.75226 WP_003433857.1.75287 WP_003433857.1.75454 WP_003433857.1.75659 WP_003433857.1.76207 WP_003433857.1.7650 WP_003433857.1.76550 WP_003433857.1.76552 WP_003433857.1.76603 WP_003433857.1.76621 WP_003433857.1.76664 WP_003433857.1.76687 WP_003433857.1.76793 WP_003433857.1.76813 WP_003433857.1.76882 WP_003433857.1.76924 WP_003433857.1.7696 WP_003433857.1.77092 WP_003433857.1.77102 WP_003433857.1.77473 WP_003433857.1.77509 WP_003433857.1.77544 WP_003433857.1.7755 WP_003433857.1.77639 WP_003433857.1.77782 WP_003433857.1.77942 WP_003433857.1.78949 WP_003433857.1.7916 WP_003433857.1.79199 WP_003433857.1.79221 WP_003433857.1.79309 WP_003433857.1.79437 WP_003433857.1.79611 WP_003433857.1.79680 WP_003433857.1.79836 WP_003433857.1.79956 WP_003433857.1.80052 WP_003433857.1.80144 WP_003433857.1.80342 WP_003433857.1.80379 WP_003433857.1.80455 WP_003433857.1.80504 WP_003433857.1.80575 WP_003433857.1.80963 WP_003433857.1.81035 WP_003433857.1.81208 WP_003433857.1.81299 WP_003433857.1.81351 WP_003433857.1.81402 WP_003433857.1.81605 WP_003433857.1.81777 WP_003433857.1.82084 WP_003433857.1.82169 WP_003433857.1.82335 WP_003433857.1.82635 WP_003433857.1.82701 WP_003433857.1.82920 WP_003433857.1.8314 WP_003433857.1.83148 WP_003433857.1.83175 WP_003433857.1.83287 WP_003433857.1.83288 WP_003433857.1.83318 WP_003433857.1.83348 WP_003433857.1.8336 WP_003433857.1.834 WP_003433857.1.83477 WP_003433857.1.83515 WP_003433857.1.83822 WP_003433857.1.83918 WP_003433857.1.84253 WP_003433857.1.84646 WP_003433857.1.84843 WP_003433857.1.84880 WP_003433857.1.84923 WP_003433857.1.85020 WP_003433857.1.85214 WP_003433857.1.85219 WP_003433857.1.8527 WP_003433857.1.85420 WP_003433857.1.85442 WP_003433857.1.85454 WP_003433857.1.85776 WP_003433857.1.85863 WP_003433857.1.8587 WP_003433857.1.85874 WP_003433857.1.85932 WP_003433857.1.86008 WP_003433857.1.86011 WP_003433857.1.86049 WP_003433857.1.86088 WP_003433857.1.86094 WP_003433857.1.86116 WP_003433857.1.86117 WP_003433857.1.86328 WP_003433857.1.86395 WP_003433857.1.86534 WP_003433857.1.86767 WP_003433857.1.86914 WP_003433857.1.87058 WP_003433857.1.87195 WP_003433857.1.87454 WP_003433857.1.87714 WP_003433857.1.87723 WP_003433857.1.87730 WP_003433857.1.87918 WP_003433857.1.87932 WP_003433857.1.88091 WP_003433857.1.882 WP_003433857.1.88268 WP_003433857.1.88332 WP_003433857.1.88372 WP_003433857.1.88377 WP_003433857.1.88608 WP_003433857.1.88640 WP_003433857.1.89052 WP_003433857.1.89065 WP_003433857.1.89196 WP_003433857.1.89337 WP_003433857.1.89364 WP_003433857.1.89457 WP_003433857.1.89629 WP_003433857.1.89697 WP_003433857.1.89994 WP_003433857.1.90076 WP_003433857.1.90101 WP_003433857.1.90164 WP_003433857.1.90329 WP_003433857.1.9041 WP_003433857.1.90491 WP_003433857.1.90555 WP_003433857.1.90643 WP_003433857.1.9083 WP_003433857.1.90921 WP_003433857.1.90938 WP_003433857.1.90981 WP_003433857.1.90985 WP_003433857.1.91065 WP_003433857.1.91254 WP_003433857.1.91314 WP_003433857.1.91406 WP_003433857.1.91570 WP_003433857.1.91648 WP_003433857.1.92371 WP_003433857.1.92576 WP_003433857.1.92658 WP_003433857.1.92697 WP_003433857.1.92941 WP_003433857.1.93044 WP_003433857.1.93171 WP_003433857.1.93313 WP_003433857.1.93360 WP_003433857.1.93480 WP_003433857.1.93615 WP_003433857.1.93687 WP_003433857.1.93717 WP_003433857.1.93766 WP_003433857.1.93782 WP_003433857.1.93798 WP_003433857.1.93802 WP_003433857.1.93830 WP_003433857.1.93968 WP_003433857.1.94067 WP_003433857.1.94073 WP_003433857.1.94768 WP_003433857.1.94968 WP_003433857.1.95095 WP_003433857.1.95173 WP_003433857.1.9522 WP_003433857.1.95350 WP_003433857.1.95517 WP_003433857.1.9580 WP_003433857.1.95847 WP_003433857.1.95893 WP_003433857.1.9635 WP_003433857.1.96503 WP_003433857.1.96505 WP_003433857.1.9666 WP_003433857.1.96690 WP_003433857.1.96765 WP_003433857.1.97219 WP_003433857.1.97458 WP_003433857.1.97672 WP_003433857.1.97682 WP_003433857.1.97806 WP_003433857.1.98037 WP_003433857.1.98514 WP_003433857.1.98622 WP_003433857.1.98698 WP_003433857.1.98715 WP_003433857.1.98748 WP_003433857.1.98856 WP_003433857.1.98997 WP_003433857.1.99064 WP_003433857.1.99134 WP_003433857.1.99333 WP_003433857.1.99542 WP_003433857.1.99545 WP_003433857.1.99731 WP_003433857.1.9986 645462.CD196_2076 645463.CDR20291_2119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]