SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260683968|ref|YP_003215253.1| from Clostridium difficile CD196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260683968|ref|YP_003215253.1|
Domain Number 1 Region: 3-123
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.39e-29
Family Penicillinase repressor 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|260683968|ref|YP_003215253.1|
Sequence length 124
Comment beta-lactamase repressor [Clostridium difficile CD196]
Sequence
MIRKIPQAELKVMKFIWKVDVTVTSKDVIEAMEQKYGWKQTTTLTLLSRLVKRGFLDAQK
IDRYTHYTIRVKHKDYLSFETKDFLSNIHDDSLRSLISALHDDENIGKDKLDFLESYFDN
LKDE
Download sequence
Identical sequences A0A069AHF0 A0A0H3N548 A0A0J0UC99 A0A125V7Q8 C9YNW7 Q181X6 T4ALZ0
WP_004454687.1.100055 WP_004454687.1.100099 WP_004454687.1.100107 WP_004454687.1.100118 WP_004454687.1.100139 WP_004454687.1.100513 WP_004454687.1.100570 WP_004454687.1.100660 WP_004454687.1.100831 WP_004454687.1.100923 WP_004454687.1.100977 WP_004454687.1.101035 WP_004454687.1.101125 WP_004454687.1.101279 WP_004454687.1.101316 WP_004454687.1.101532 WP_004454687.1.101861 WP_004454687.1.101929 WP_004454687.1.102031 WP_004454687.1.102074 WP_004454687.1.102095 WP_004454687.1.10483 WP_004454687.1.10488 WP_004454687.1.10582 WP_004454687.1.10691 WP_004454687.1.10793 WP_004454687.1.10795 WP_004454687.1.11025 WP_004454687.1.11224 WP_004454687.1.11278 WP_004454687.1.11320 WP_004454687.1.11398 WP_004454687.1.1167 WP_004454687.1.11937 WP_004454687.1.12066 WP_004454687.1.12385 WP_004454687.1.1254 WP_004454687.1.12629 WP_004454687.1.12632 WP_004454687.1.12659 WP_004454687.1.12807 WP_004454687.1.12809 WP_004454687.1.12953 WP_004454687.1.13040 WP_004454687.1.13251 WP_004454687.1.13273 WP_004454687.1.13398 WP_004454687.1.13730 WP_004454687.1.13841 WP_004454687.1.13859 WP_004454687.1.141 WP_004454687.1.14170 WP_004454687.1.14177 WP_004454687.1.14205 WP_004454687.1.1422 WP_004454687.1.14259 WP_004454687.1.14330 WP_004454687.1.14352 WP_004454687.1.1445 WP_004454687.1.14457 WP_004454687.1.14483 WP_004454687.1.14579 WP_004454687.1.14686 WP_004454687.1.14698 WP_004454687.1.1494 WP_004454687.1.15083 WP_004454687.1.15097 WP_004454687.1.15192 WP_004454687.1.15435 WP_004454687.1.15908 WP_004454687.1.16376 WP_004454687.1.16520 WP_004454687.1.16728 WP_004454687.1.16897 WP_004454687.1.169 WP_004454687.1.16931 WP_004454687.1.16966 WP_004454687.1.1705 WP_004454687.1.17371 WP_004454687.1.17512 WP_004454687.1.17611 WP_004454687.1.17808 WP_004454687.1.17851 WP_004454687.1.17908 WP_004454687.1.17960 WP_004454687.1.18060 WP_004454687.1.18207 WP_004454687.1.18212 WP_004454687.1.18298 WP_004454687.1.1838 WP_004454687.1.18407 WP_004454687.1.18455 WP_004454687.1.18551 WP_004454687.1.18680 WP_004454687.1.18805 WP_004454687.1.18970 WP_004454687.1.19088 WP_004454687.1.19152 WP_004454687.1.1926 WP_004454687.1.19290 WP_004454687.1.1934 WP_004454687.1.19648 WP_004454687.1.19704 WP_004454687.1.19899 WP_004454687.1.19956 WP_004454687.1.1999 WP_004454687.1.2002 WP_004454687.1.20132 WP_004454687.1.20184 WP_004454687.1.20302 WP_004454687.1.20313 WP_004454687.1.20650 WP_004454687.1.20728 WP_004454687.1.20872 WP_004454687.1.20960 WP_004454687.1.21000 WP_004454687.1.21048 WP_004454687.1.21201 WP_004454687.1.21220 WP_004454687.1.21417 WP_004454687.1.21502 WP_004454687.1.21520 WP_004454687.1.21547 WP_004454687.1.21618 WP_004454687.1.21704 WP_004454687.1.22020 WP_004454687.1.22079 WP_004454687.1.22222 WP_004454687.1.22357 WP_004454687.1.22411 WP_004454687.1.22417 WP_004454687.1.22569 WP_004454687.1.22615 WP_004454687.1.22768 WP_004454687.1.22893 WP_004454687.1.22937 WP_004454687.1.23208 WP_004454687.1.23287 WP_004454687.1.23338 WP_004454687.1.2363 WP_004454687.1.24197 WP_004454687.1.24457 WP_004454687.1.24520 WP_004454687.1.24826 WP_004454687.1.24889 WP_004454687.1.24900 WP_004454687.1.25128 WP_004454687.1.25761 WP_004454687.1.26024 WP_004454687.1.26044 WP_004454687.1.26358 WP_004454687.1.26482 WP_004454687.1.26940 WP_004454687.1.2758 WP_004454687.1.27677 WP_004454687.1.27708 WP_004454687.1.27824 WP_004454687.1.27872 WP_004454687.1.27881 WP_004454687.1.27890 WP_004454687.1.27967 WP_004454687.1.27989 WP_004454687.1.27996 WP_004454687.1.28055 WP_004454687.1.28410 WP_004454687.1.28638 WP_004454687.1.28715 WP_004454687.1.28856 WP_004454687.1.28882 WP_004454687.1.28890 WP_004454687.1.28930 WP_004454687.1.2923 WP_004454687.1.29600 WP_004454687.1.29757 WP_004454687.1.29891 WP_004454687.1.3024 WP_004454687.1.3031 WP_004454687.1.30420 WP_004454687.1.30431 WP_004454687.1.30463 WP_004454687.1.30519 WP_004454687.1.30521 WP_004454687.1.30743 WP_004454687.1.30841 WP_004454687.1.30953 WP_004454687.1.31160 WP_004454687.1.31183 WP_004454687.1.31203 WP_004454687.1.31292 WP_004454687.1.31309 WP_004454687.1.31351 WP_004454687.1.31385 WP_004454687.1.31453 WP_004454687.1.31475 WP_004454687.1.31477 WP_004454687.1.31637 WP_004454687.1.31719 WP_004454687.1.31742 WP_004454687.1.31969 WP_004454687.1.32008 WP_004454687.1.32066 WP_004454687.1.32119 WP_004454687.1.32166 WP_004454687.1.32218 WP_004454687.1.32230 WP_004454687.1.32294 WP_004454687.1.32699 WP_004454687.1.32769 WP_004454687.1.32776 WP_004454687.1.32842 WP_004454687.1.33056 WP_004454687.1.33098 WP_004454687.1.33298 WP_004454687.1.33332 WP_004454687.1.33349 WP_004454687.1.3340 WP_004454687.1.33514 WP_004454687.1.33810 WP_004454687.1.34489 WP_004454687.1.34545 WP_004454687.1.34641 WP_004454687.1.34800 WP_004454687.1.34985 WP_004454687.1.34989 WP_004454687.1.35 WP_004454687.1.35002 WP_004454687.1.35137 WP_004454687.1.35181 WP_004454687.1.35187 WP_004454687.1.35234 WP_004454687.1.3559 WP_004454687.1.35832 WP_004454687.1.35884 WP_004454687.1.36078 WP_004454687.1.36257 WP_004454687.1.36338 WP_004454687.1.36738 WP_004454687.1.36835 WP_004454687.1.37255 WP_004454687.1.374 WP_004454687.1.37532 WP_004454687.1.37597 WP_004454687.1.37861 WP_004454687.1.3789 WP_004454687.1.37957 WP_004454687.1.37981 WP_004454687.1.38305 WP_004454687.1.38338 WP_004454687.1.38692 WP_004454687.1.38775 WP_004454687.1.38814 WP_004454687.1.38874 WP_004454687.1.3913 WP_004454687.1.39213 WP_004454687.1.39382 WP_004454687.1.39442 WP_004454687.1.39525 WP_004454687.1.39621 WP_004454687.1.39874 WP_004454687.1.39876 WP_004454687.1.39975 WP_004454687.1.40030 WP_004454687.1.40294 WP_004454687.1.40313 WP_004454687.1.40447 WP_004454687.1.40522 WP_004454687.1.40557 WP_004454687.1.407 WP_004454687.1.40775 WP_004454687.1.40891 WP_004454687.1.40959 WP_004454687.1.40966 WP_004454687.1.41131 WP_004454687.1.4121 WP_004454687.1.41342 WP_004454687.1.4137 WP_004454687.1.41534 WP_004454687.1.41641 WP_004454687.1.41687 WP_004454687.1.42035 WP_004454687.1.4204 WP_004454687.1.42066 WP_004454687.1.42532 WP_004454687.1.42533 WP_004454687.1.42610 WP_004454687.1.42664 WP_004454687.1.43112 WP_004454687.1.4321 WP_004454687.1.43490 WP_004454687.1.43519 WP_004454687.1.43663 WP_004454687.1.43824 WP_004454687.1.4383 WP_004454687.1.44030 WP_004454687.1.44105 WP_004454687.1.44149 WP_004454687.1.44198 WP_004454687.1.44241 WP_004454687.1.44470 WP_004454687.1.44729 WP_004454687.1.45017 WP_004454687.1.45142 WP_004454687.1.45165 WP_004454687.1.45209 WP_004454687.1.45257 WP_004454687.1.45352 WP_004454687.1.45554 WP_004454687.1.4573 WP_004454687.1.45938 WP_004454687.1.46066 WP_004454687.1.46274 WP_004454687.1.46280 WP_004454687.1.46305 WP_004454687.1.4698 WP_004454687.1.47016 WP_004454687.1.47121 WP_004454687.1.47173 WP_004454687.1.47227 WP_004454687.1.47228 WP_004454687.1.47479 WP_004454687.1.47615 WP_004454687.1.47708 WP_004454687.1.47729 WP_004454687.1.48246 WP_004454687.1.48279 WP_004454687.1.4835 WP_004454687.1.48746 WP_004454687.1.48935 WP_004454687.1.48980 WP_004454687.1.48983 WP_004454687.1.48991 WP_004454687.1.49020 WP_004454687.1.49054 WP_004454687.1.49065 WP_004454687.1.4908 WP_004454687.1.49092 WP_004454687.1.49230 WP_004454687.1.49310 WP_004454687.1.4948 WP_004454687.1.49633 WP_004454687.1.50159 WP_004454687.1.50341 WP_004454687.1.50460 WP_004454687.1.5073 WP_004454687.1.50865 WP_004454687.1.51007 WP_004454687.1.51235 WP_004454687.1.51675 WP_004454687.1.5187 WP_004454687.1.51996 WP_004454687.1.52073 WP_004454687.1.52278 WP_004454687.1.52294 WP_004454687.1.52311 WP_004454687.1.52330 WP_004454687.1.52402 WP_004454687.1.52466 WP_004454687.1.52525 WP_004454687.1.52958 WP_004454687.1.52997 WP_004454687.1.53008 WP_004454687.1.53044 WP_004454687.1.53055 WP_004454687.1.5337 WP_004454687.1.53504 WP_004454687.1.53704 WP_004454687.1.53710 WP_004454687.1.53729 WP_004454687.1.53987 WP_004454687.1.54058 WP_004454687.1.54153 WP_004454687.1.5423 WP_004454687.1.54262 WP_004454687.1.54350 WP_004454687.1.54586 WP_004454687.1.54593 WP_004454687.1.54692 WP_004454687.1.55055 WP_004454687.1.55101 WP_004454687.1.55302 WP_004454687.1.55371 WP_004454687.1.55391 WP_004454687.1.5558 WP_004454687.1.559 WP_004454687.1.56006 WP_004454687.1.56217 WP_004454687.1.56252 WP_004454687.1.56323 WP_004454687.1.56337 WP_004454687.1.5657 WP_004454687.1.5664 WP_004454687.1.56664 WP_004454687.1.56754 WP_004454687.1.56927 WP_004454687.1.56998 WP_004454687.1.57337 WP_004454687.1.57711 WP_004454687.1.57827 WP_004454687.1.58216 WP_004454687.1.58304 WP_004454687.1.58315 WP_004454687.1.58323 WP_004454687.1.58463 WP_004454687.1.58531 WP_004454687.1.58665 WP_004454687.1.58677 WP_004454687.1.58711 WP_004454687.1.58956 WP_004454687.1.5905 WP_004454687.1.59588 WP_004454687.1.59618 WP_004454687.1.59628 WP_004454687.1.59707 WP_004454687.1.59752 WP_004454687.1.60040 WP_004454687.1.6031 WP_004454687.1.60482 WP_004454687.1.60563 WP_004454687.1.6070 WP_004454687.1.60957 WP_004454687.1.61042 WP_004454687.1.61140 WP_004454687.1.61492 WP_004454687.1.61679 WP_004454687.1.61716 WP_004454687.1.61866 WP_004454687.1.61972 WP_004454687.1.62049 WP_004454687.1.62095 WP_004454687.1.62128 WP_004454687.1.62340 WP_004454687.1.62577 WP_004454687.1.62624 WP_004454687.1.62637 WP_004454687.1.62986 WP_004454687.1.63020 WP_004454687.1.63059 WP_004454687.1.63237 WP_004454687.1.63239 WP_004454687.1.63248 WP_004454687.1.63343 WP_004454687.1.63378 WP_004454687.1.63516 WP_004454687.1.63570 WP_004454687.1.63581 WP_004454687.1.63598 WP_004454687.1.63599 WP_004454687.1.63696 WP_004454687.1.63804 WP_004454687.1.63853 WP_004454687.1.64020 WP_004454687.1.64092 WP_004454687.1.64197 WP_004454687.1.64369 WP_004454687.1.64447 WP_004454687.1.64546 WP_004454687.1.64859 WP_004454687.1.65064 WP_004454687.1.65067 WP_004454687.1.65369 WP_004454687.1.65889 WP_004454687.1.66084 WP_004454687.1.66119 WP_004454687.1.66237 WP_004454687.1.66439 WP_004454687.1.66474 WP_004454687.1.66565 WP_004454687.1.66643 WP_004454687.1.66701 WP_004454687.1.6675 WP_004454687.1.66805 WP_004454687.1.66847 WP_004454687.1.6685 WP_004454687.1.66887 WP_004454687.1.66888 WP_004454687.1.670 WP_004454687.1.67303 WP_004454687.1.67308 WP_004454687.1.6736 WP_004454687.1.67368 WP_004454687.1.67528 WP_004454687.1.67689 WP_004454687.1.67711 WP_004454687.1.6792 WP_004454687.1.67951 WP_004454687.1.68150 WP_004454687.1.68276 WP_004454687.1.68955 WP_004454687.1.6898 WP_004454687.1.68980 WP_004454687.1.69114 WP_004454687.1.692 WP_004454687.1.69333 WP_004454687.1.69495 WP_004454687.1.6994 WP_004454687.1.700 WP_004454687.1.70152 WP_004454687.1.70179 WP_004454687.1.70231 WP_004454687.1.70320 WP_004454687.1.71079 WP_004454687.1.71119 WP_004454687.1.71384 WP_004454687.1.7156 WP_004454687.1.71745 WP_004454687.1.7199 WP_004454687.1.72113 WP_004454687.1.72245 WP_004454687.1.72468 WP_004454687.1.72483 WP_004454687.1.72560 WP_004454687.1.72682 WP_004454687.1.72909 WP_004454687.1.72914 WP_004454687.1.72994 WP_004454687.1.73026 WP_004454687.1.73116 WP_004454687.1.7322 WP_004454687.1.73852 WP_004454687.1.73931 WP_004454687.1.74050 WP_004454687.1.74116 WP_004454687.1.74126 WP_004454687.1.74672 WP_004454687.1.74678 WP_004454687.1.74680 WP_004454687.1.74835 WP_004454687.1.74897 WP_004454687.1.75026 WP_004454687.1.751 WP_004454687.1.75210 WP_004454687.1.75454 WP_004454687.1.75638 WP_004454687.1.75659 WP_004454687.1.76207 WP_004454687.1.7650 WP_004454687.1.76550 WP_004454687.1.76552 WP_004454687.1.76603 WP_004454687.1.76621 WP_004454687.1.76664 WP_004454687.1.76793 WP_004454687.1.76813 WP_004454687.1.76882 WP_004454687.1.76924 WP_004454687.1.7696 WP_004454687.1.77092 WP_004454687.1.77102 WP_004454687.1.77473 WP_004454687.1.77509 WP_004454687.1.77544 WP_004454687.1.7755 WP_004454687.1.77639 WP_004454687.1.77782 WP_004454687.1.77942 WP_004454687.1.78123 WP_004454687.1.78579 WP_004454687.1.78949 WP_004454687.1.7916 WP_004454687.1.79221 WP_004454687.1.79309 WP_004454687.1.79344 WP_004454687.1.79437 WP_004454687.1.79611 WP_004454687.1.79680 WP_004454687.1.79703 WP_004454687.1.79836 WP_004454687.1.79956 WP_004454687.1.80052 WP_004454687.1.80144 WP_004454687.1.80342 WP_004454687.1.80379 WP_004454687.1.80575 WP_004454687.1.80963 WP_004454687.1.81035 WP_004454687.1.81044 WP_004454687.1.81208 WP_004454687.1.81299 WP_004454687.1.81351 WP_004454687.1.81402 WP_004454687.1.81605 WP_004454687.1.81777 WP_004454687.1.82002 WP_004454687.1.82084 WP_004454687.1.82150 WP_004454687.1.82169 WP_004454687.1.82335 WP_004454687.1.82635 WP_004454687.1.82701 WP_004454687.1.82920 WP_004454687.1.8314 WP_004454687.1.83148 WP_004454687.1.83175 WP_004454687.1.83255 WP_004454687.1.83287 WP_004454687.1.83288 WP_004454687.1.83318 WP_004454687.1.83348 WP_004454687.1.834 WP_004454687.1.83477 WP_004454687.1.83515 WP_004454687.1.83822 WP_004454687.1.84253 WP_004454687.1.84528 WP_004454687.1.84646 WP_004454687.1.84843 WP_004454687.1.84880 WP_004454687.1.84923 WP_004454687.1.85020 WP_004454687.1.85127 WP_004454687.1.85214 WP_004454687.1.85219 WP_004454687.1.8527 WP_004454687.1.85420 WP_004454687.1.85442 WP_004454687.1.85454 WP_004454687.1.85776 WP_004454687.1.85863 WP_004454687.1.85874 WP_004454687.1.85932 WP_004454687.1.86008 WP_004454687.1.86011 WP_004454687.1.86049 WP_004454687.1.86094 WP_004454687.1.86116 WP_004454687.1.86117 WP_004454687.1.86328 WP_004454687.1.86395 WP_004454687.1.86534 WP_004454687.1.86618 WP_004454687.1.86743 WP_004454687.1.86767 WP_004454687.1.86837 WP_004454687.1.86914 WP_004454687.1.87058 WP_004454687.1.87195 WP_004454687.1.87326 WP_004454687.1.87454 WP_004454687.1.87714 WP_004454687.1.87723 WP_004454687.1.87918 WP_004454687.1.87932 WP_004454687.1.882 WP_004454687.1.88268 WP_004454687.1.88332 WP_004454687.1.88372 WP_004454687.1.88377 WP_004454687.1.88608 WP_004454687.1.88996 WP_004454687.1.89065 WP_004454687.1.89196 WP_004454687.1.89541 WP_004454687.1.89629 WP_004454687.1.89697 WP_004454687.1.89994 WP_004454687.1.90076 WP_004454687.1.90101 WP_004454687.1.90164 WP_004454687.1.9041 WP_004454687.1.90491 WP_004454687.1.90643 WP_004454687.1.9083 WP_004454687.1.90921 WP_004454687.1.90938 WP_004454687.1.90981 WP_004454687.1.91065 WP_004454687.1.91254 WP_004454687.1.91406 WP_004454687.1.91648 WP_004454687.1.92075 WP_004454687.1.92284 WP_004454687.1.92371 WP_004454687.1.92576 WP_004454687.1.92658 WP_004454687.1.92697 WP_004454687.1.92941 WP_004454687.1.93044 WP_004454687.1.93171 WP_004454687.1.93313 WP_004454687.1.93360 WP_004454687.1.93480 WP_004454687.1.93615 WP_004454687.1.93687 WP_004454687.1.93717 WP_004454687.1.93766 WP_004454687.1.93782 WP_004454687.1.93798 WP_004454687.1.93802 WP_004454687.1.93830 WP_004454687.1.94067 WP_004454687.1.94166 WP_004454687.1.94427 WP_004454687.1.94768 WP_004454687.1.94831 WP_004454687.1.94968 WP_004454687.1.95095 WP_004454687.1.95173 WP_004454687.1.9522 WP_004454687.1.95350 WP_004454687.1.95517 WP_004454687.1.95847 WP_004454687.1.95893 WP_004454687.1.9635 WP_004454687.1.96503 WP_004454687.1.96505 WP_004454687.1.9666 WP_004454687.1.96690 WP_004454687.1.96765 WP_004454687.1.97219 WP_004454687.1.97458 WP_004454687.1.97672 WP_004454687.1.97682 WP_004454687.1.98037 WP_004454687.1.98514 WP_004454687.1.98622 WP_004454687.1.98698 WP_004454687.1.98715 WP_004454687.1.98748 WP_004454687.1.98856 WP_004454687.1.98913 WP_004454687.1.98997 WP_004454687.1.99064 WP_004454687.1.99134 WP_004454687.1.99333 WP_004454687.1.99542 WP_004454687.1.99545 WP_004454687.1.99731 WP_004454687.1.9986 YP_001088902.1.32744 272563.CD2390 645462.CD196_2232 645463.CDR20291_2280 gi|126700005|ref|YP_001088902.1| gi|260687628|ref|YP_003218762.1| gi|384361608|ref|YP_006199460.1| gi|260683968|ref|YP_003215253.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]