SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260683983|ref|YP_003215268.1| from Clostridium difficile CD196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260683983|ref|YP_003215268.1|
Domain Number 1 Region: 38-158
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.11e-26
Family MarR-like transcriptional regulators 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|260683983|ref|YP_003215268.1|
Sequence length 161
Comment MarR family transcriptional regulator [Clostridium difficile CD196]
Sequence
MDNNNILKIADSFLDFLFVLENNIFKESDLLKKFQNNSDIMKAYFEECPMAPSHAKVILY
LMTSNSSSISQIASNLGILKSNMTPIIDRLVEHGLVNKFPDPKDRRILRVELTDKAFKLF
DAVKAILKESLVKKLSNLSEEELTLLDEHTLKLSEIVKKLG
Download sequence
Identical sequences A0A031WGR4 A0A0H3N561 A0A0J0UC96 A0A125V7D6 A0A1F2DHH6 C9YNY2 Q181Z1 T4APA2 T4HGC8
gi|126700020|ref|YP_001088917.1| gi|260687643|ref|YP_003218777.1| gi|384361624|ref|YP_006199476.1| WP_004454702.1.100055 WP_004454702.1.100097 WP_004454702.1.100107 WP_004454702.1.100118 WP_004454702.1.100139 WP_004454702.1.100513 WP_004454702.1.100660 WP_004454702.1.100831 WP_004454702.1.100977 WP_004454702.1.101035 WP_004454702.1.101125 WP_004454702.1.101279 WP_004454702.1.10130 WP_004454702.1.101316 WP_004454702.1.101532 WP_004454702.1.101861 WP_004454702.1.102031 WP_004454702.1.102074 WP_004454702.1.102095 WP_004454702.1.10483 WP_004454702.1.10488 WP_004454702.1.10582 WP_004454702.1.10691 WP_004454702.1.10793 WP_004454702.1.10795 WP_004454702.1.11025 WP_004454702.1.11224 WP_004454702.1.11278 WP_004454702.1.11320 WP_004454702.1.11398 WP_004454702.1.1167 WP_004454702.1.1179 WP_004454702.1.11937 WP_004454702.1.12066 WP_004454702.1.12169 WP_004454702.1.12385 WP_004454702.1.1254 WP_004454702.1.12629 WP_004454702.1.12632 WP_004454702.1.12659 WP_004454702.1.1273 WP_004454702.1.12734 WP_004454702.1.12807 WP_004454702.1.12809 WP_004454702.1.13040 WP_004454702.1.13251 WP_004454702.1.13273 WP_004454702.1.13398 WP_004454702.1.13418 WP_004454702.1.13730 WP_004454702.1.13841 WP_004454702.1.13859 WP_004454702.1.14045 WP_004454702.1.141 WP_004454702.1.14170 WP_004454702.1.14177 WP_004454702.1.14205 WP_004454702.1.1422 WP_004454702.1.14259 WP_004454702.1.14330 WP_004454702.1.14352 WP_004454702.1.1445 WP_004454702.1.14457 WP_004454702.1.14483 WP_004454702.1.14579 WP_004454702.1.14674 WP_004454702.1.14686 WP_004454702.1.14698 WP_004454702.1.14848 WP_004454702.1.1494 WP_004454702.1.15083 WP_004454702.1.15097 WP_004454702.1.15192 WP_004454702.1.15205 WP_004454702.1.15310 WP_004454702.1.15435 WP_004454702.1.15908 WP_004454702.1.16012 WP_004454702.1.16135 WP_004454702.1.16185 WP_004454702.1.16376 WP_004454702.1.16520 WP_004454702.1.16728 WP_004454702.1.169 WP_004454702.1.16931 WP_004454702.1.16966 WP_004454702.1.1705 WP_004454702.1.17371 WP_004454702.1.17413 WP_004454702.1.17463 WP_004454702.1.17512 WP_004454702.1.17611 WP_004454702.1.17638 WP_004454702.1.17808 WP_004454702.1.17851 WP_004454702.1.17879 WP_004454702.1.17908 WP_004454702.1.17960 WP_004454702.1.18060 WP_004454702.1.18207 WP_004454702.1.18212 WP_004454702.1.18298 WP_004454702.1.1838 WP_004454702.1.18407 WP_004454702.1.18455 WP_004454702.1.18462 WP_004454702.1.18551 WP_004454702.1.18680 WP_004454702.1.18805 WP_004454702.1.18970 WP_004454702.1.19088 WP_004454702.1.19152 WP_004454702.1.1926 WP_004454702.1.19290 WP_004454702.1.1934 WP_004454702.1.19648 WP_004454702.1.19704 WP_004454702.1.19899 WP_004454702.1.19956 WP_004454702.1.1999 WP_004454702.1.2002 WP_004454702.1.20132 WP_004454702.1.20184 WP_004454702.1.20302 WP_004454702.1.20313 WP_004454702.1.20481 WP_004454702.1.20650 WP_004454702.1.20728 WP_004454702.1.20872 WP_004454702.1.20875 WP_004454702.1.20960 WP_004454702.1.21000 WP_004454702.1.21048 WP_004454702.1.21201 WP_004454702.1.21220 WP_004454702.1.21417 WP_004454702.1.21520 WP_004454702.1.21547 WP_004454702.1.21618 WP_004454702.1.21704 WP_004454702.1.21893 WP_004454702.1.22020 WP_004454702.1.22079 WP_004454702.1.22222 WP_004454702.1.22228 WP_004454702.1.22313 WP_004454702.1.22411 WP_004454702.1.22417 WP_004454702.1.22568 WP_004454702.1.22569 WP_004454702.1.22615 WP_004454702.1.22768 WP_004454702.1.22893 WP_004454702.1.22937 WP_004454702.1.23096 WP_004454702.1.23208 WP_004454702.1.23287 WP_004454702.1.23338 WP_004454702.1.2363 WP_004454702.1.24197 WP_004454702.1.24457 WP_004454702.1.24520 WP_004454702.1.24889 WP_004454702.1.24900 WP_004454702.1.24987 WP_004454702.1.25128 WP_004454702.1.25416 WP_004454702.1.25761 WP_004454702.1.26024 WP_004454702.1.26358 WP_004454702.1.26482 WP_004454702.1.26494 WP_004454702.1.26697 WP_004454702.1.26829 WP_004454702.1.26940 WP_004454702.1.2758 WP_004454702.1.27677 WP_004454702.1.27708 WP_004454702.1.27824 WP_004454702.1.27872 WP_004454702.1.27881 WP_004454702.1.27890 WP_004454702.1.27967 WP_004454702.1.27989 WP_004454702.1.27996 WP_004454702.1.28055 WP_004454702.1.28410 WP_004454702.1.28638 WP_004454702.1.28715 WP_004454702.1.28856 WP_004454702.1.28882 WP_004454702.1.28890 WP_004454702.1.28930 WP_004454702.1.2923 WP_004454702.1.293 WP_004454702.1.29600 WP_004454702.1.29757 WP_004454702.1.2982 WP_004454702.1.29891 WP_004454702.1.3024 WP_004454702.1.303 WP_004454702.1.3031 WP_004454702.1.30420 WP_004454702.1.30431 WP_004454702.1.30463 WP_004454702.1.30519 WP_004454702.1.30521 WP_004454702.1.30743 WP_004454702.1.30841 WP_004454702.1.30953 WP_004454702.1.31160 WP_004454702.1.31183 WP_004454702.1.31203 WP_004454702.1.31292 WP_004454702.1.31309 WP_004454702.1.31351 WP_004454702.1.31385 WP_004454702.1.31453 WP_004454702.1.31475 WP_004454702.1.31477 WP_004454702.1.31519 WP_004454702.1.31637 WP_004454702.1.31719 WP_004454702.1.31742 WP_004454702.1.31960 WP_004454702.1.31969 WP_004454702.1.32008 WP_004454702.1.32066 WP_004454702.1.32119 WP_004454702.1.32166 WP_004454702.1.32197 WP_004454702.1.32218 WP_004454702.1.32230 WP_004454702.1.32294 WP_004454702.1.32699 WP_004454702.1.32769 WP_004454702.1.32776 WP_004454702.1.32842 WP_004454702.1.33056 WP_004454702.1.33098 WP_004454702.1.33164 WP_004454702.1.33298 WP_004454702.1.33332 WP_004454702.1.33349 WP_004454702.1.3340 WP_004454702.1.33514 WP_004454702.1.33810 WP_004454702.1.34388 WP_004454702.1.34489 WP_004454702.1.34545 WP_004454702.1.34641 WP_004454702.1.34800 WP_004454702.1.34985 WP_004454702.1.35 WP_004454702.1.35002 WP_004454702.1.35137 WP_004454702.1.35181 WP_004454702.1.35187 WP_004454702.1.35234 WP_004454702.1.3559 WP_004454702.1.35832 WP_004454702.1.35884 WP_004454702.1.36078 WP_004454702.1.36257 WP_004454702.1.36338 WP_004454702.1.36738 WP_004454702.1.36835 WP_004454702.1.37255 WP_004454702.1.374 WP_004454702.1.37493 WP_004454702.1.37532 WP_004454702.1.37597 WP_004454702.1.37861 WP_004454702.1.3789 WP_004454702.1.37957 WP_004454702.1.37981 WP_004454702.1.38305 WP_004454702.1.38338 WP_004454702.1.38692 WP_004454702.1.38775 WP_004454702.1.38814 WP_004454702.1.38874 WP_004454702.1.38924 WP_004454702.1.38986 WP_004454702.1.39008 WP_004454702.1.3913 WP_004454702.1.39213 WP_004454702.1.39350 WP_004454702.1.39382 WP_004454702.1.39442 WP_004454702.1.39525 WP_004454702.1.39621 WP_004454702.1.39783 WP_004454702.1.39874 WP_004454702.1.39876 WP_004454702.1.39975 WP_004454702.1.39981 WP_004454702.1.40030 WP_004454702.1.40294 WP_004454702.1.40313 WP_004454702.1.40447 WP_004454702.1.40522 WP_004454702.1.40557 WP_004454702.1.407 WP_004454702.1.40775 WP_004454702.1.40891 WP_004454702.1.40959 WP_004454702.1.40966 WP_004454702.1.41131 WP_004454702.1.4121 WP_004454702.1.41334 WP_004454702.1.41342 WP_004454702.1.4137 WP_004454702.1.41506 WP_004454702.1.41534 WP_004454702.1.41641 WP_004454702.1.41687 WP_004454702.1.41818 WP_004454702.1.41995 WP_004454702.1.42035 WP_004454702.1.4204 WP_004454702.1.42066 WP_004454702.1.42532 WP_004454702.1.42533 WP_004454702.1.42610 WP_004454702.1.42664 WP_004454702.1.43112 WP_004454702.1.4315 WP_004454702.1.4321 WP_004454702.1.43388 WP_004454702.1.43490 WP_004454702.1.43519 WP_004454702.1.43579 WP_004454702.1.43663 WP_004454702.1.43824 WP_004454702.1.4383 WP_004454702.1.44030 WP_004454702.1.44105 WP_004454702.1.44149 WP_004454702.1.44198 WP_004454702.1.44241 WP_004454702.1.44470 WP_004454702.1.44471 WP_004454702.1.44729 WP_004454702.1.45017 WP_004454702.1.45059 WP_004454702.1.45142 WP_004454702.1.45165 WP_004454702.1.45209 WP_004454702.1.45257 WP_004454702.1.45352 WP_004454702.1.45554 WP_004454702.1.4573 WP_004454702.1.45938 WP_004454702.1.45986 WP_004454702.1.46066 WP_004454702.1.46274 WP_004454702.1.46280 WP_004454702.1.46305 WP_004454702.1.46522 WP_004454702.1.4698 WP_004454702.1.47016 WP_004454702.1.47121 WP_004454702.1.47227 WP_004454702.1.47228 WP_004454702.1.47479 WP_004454702.1.47615 WP_004454702.1.47708 WP_004454702.1.47729 WP_004454702.1.47940 WP_004454702.1.48246 WP_004454702.1.48279 WP_004454702.1.4835 WP_004454702.1.48746 WP_004454702.1.48772 WP_004454702.1.48935 WP_004454702.1.48980 WP_004454702.1.48983 WP_004454702.1.48991 WP_004454702.1.49020 WP_004454702.1.49054 WP_004454702.1.49065 WP_004454702.1.4908 WP_004454702.1.49092 WP_004454702.1.49230 WP_004454702.1.49310 WP_004454702.1.49339 WP_004454702.1.4948 WP_004454702.1.49633 WP_004454702.1.50159 WP_004454702.1.50341 WP_004454702.1.5073 WP_004454702.1.50865 WP_004454702.1.51007 WP_004454702.1.51235 WP_004454702.1.51675 WP_004454702.1.51996 WP_004454702.1.52073 WP_004454702.1.52266 WP_004454702.1.52278 WP_004454702.1.52311 WP_004454702.1.52330 WP_004454702.1.52383 WP_004454702.1.52402 WP_004454702.1.52466 WP_004454702.1.52525 WP_004454702.1.52789 WP_004454702.1.52958 WP_004454702.1.52997 WP_004454702.1.53008 WP_004454702.1.53044 WP_004454702.1.53055 WP_004454702.1.5337 WP_004454702.1.53504 WP_004454702.1.53704 WP_004454702.1.53710 WP_004454702.1.53729 WP_004454702.1.53987 WP_004454702.1.54058 WP_004454702.1.54153 WP_004454702.1.5423 WP_004454702.1.54262 WP_004454702.1.54350 WP_004454702.1.54586 WP_004454702.1.54692 WP_004454702.1.55055 WP_004454702.1.55101 WP_004454702.1.5521 WP_004454702.1.55302 WP_004454702.1.55371 WP_004454702.1.55391 WP_004454702.1.5558 WP_004454702.1.559 WP_004454702.1.56006 WP_004454702.1.56217 WP_004454702.1.56252 WP_004454702.1.56323 WP_004454702.1.56337 WP_004454702.1.56556 WP_004454702.1.5657 WP_004454702.1.5661 WP_004454702.1.5664 WP_004454702.1.56664 WP_004454702.1.56711 WP_004454702.1.56754 WP_004454702.1.56927 WP_004454702.1.56998 WP_004454702.1.57337 WP_004454702.1.5750 WP_004454702.1.57711 WP_004454702.1.57827 WP_004454702.1.58015 WP_004454702.1.58216 WP_004454702.1.58304 WP_004454702.1.58315 WP_004454702.1.58323 WP_004454702.1.58463 WP_004454702.1.58531 WP_004454702.1.58665 WP_004454702.1.58711 WP_004454702.1.58818 WP_004454702.1.58956 WP_004454702.1.5905 WP_004454702.1.59588 WP_004454702.1.59618 WP_004454702.1.59628 WP_004454702.1.59707 WP_004454702.1.59752 WP_004454702.1.59990 WP_004454702.1.6031 WP_004454702.1.60482 WP_004454702.1.60563 WP_004454702.1.6070 WP_004454702.1.60957 WP_004454702.1.60998 WP_004454702.1.61042 WP_004454702.1.61140 WP_004454702.1.61293 WP_004454702.1.61492 WP_004454702.1.61679 WP_004454702.1.61716 WP_004454702.1.61866 WP_004454702.1.61972 WP_004454702.1.62049 WP_004454702.1.62095 WP_004454702.1.62128 WP_004454702.1.62340 WP_004454702.1.62577 WP_004454702.1.62624 WP_004454702.1.62637 WP_004454702.1.62941 WP_004454702.1.62986 WP_004454702.1.63020 WP_004454702.1.63059 WP_004454702.1.63239 WP_004454702.1.63248 WP_004454702.1.63343 WP_004454702.1.63378 WP_004454702.1.63516 WP_004454702.1.63570 WP_004454702.1.63581 WP_004454702.1.63598 WP_004454702.1.63599 WP_004454702.1.63696 WP_004454702.1.63804 WP_004454702.1.63853 WP_004454702.1.64020 WP_004454702.1.64092 WP_004454702.1.64197 WP_004454702.1.64369 WP_004454702.1.64447 WP_004454702.1.64546 WP_004454702.1.64573 WP_004454702.1.64859 WP_004454702.1.65064 WP_004454702.1.65067 WP_004454702.1.65369 WP_004454702.1.65889 WP_004454702.1.66084 WP_004454702.1.66119 WP_004454702.1.66237 WP_004454702.1.66439 WP_004454702.1.66474 WP_004454702.1.66565 WP_004454702.1.66587 WP_004454702.1.66608 WP_004454702.1.66643 WP_004454702.1.66701 WP_004454702.1.6671 WP_004454702.1.6675 WP_004454702.1.66805 WP_004454702.1.66847 WP_004454702.1.6685 WP_004454702.1.66887 WP_004454702.1.66888 WP_004454702.1.66900 WP_004454702.1.670 WP_004454702.1.67303 WP_004454702.1.67308 WP_004454702.1.6736 WP_004454702.1.67368 WP_004454702.1.67528 WP_004454702.1.67689 WP_004454702.1.67695 WP_004454702.1.67711 WP_004454702.1.6792 WP_004454702.1.67951 WP_004454702.1.68150 WP_004454702.1.68322 WP_004454702.1.68955 WP_004454702.1.6898 WP_004454702.1.68980 WP_004454702.1.69114 WP_004454702.1.692 WP_004454702.1.69220 WP_004454702.1.69333 WP_004454702.1.69495 WP_004454702.1.69708 WP_004454702.1.6994 WP_004454702.1.700 WP_004454702.1.70152 WP_004454702.1.70179 WP_004454702.1.70231 WP_004454702.1.70320 WP_004454702.1.70695 WP_004454702.1.70710 WP_004454702.1.70820 WP_004454702.1.70886 WP_004454702.1.71079 WP_004454702.1.71119 WP_004454702.1.713 WP_004454702.1.71384 WP_004454702.1.71477 WP_004454702.1.7156 WP_004454702.1.71745 WP_004454702.1.7199 WP_004454702.1.72113 WP_004454702.1.72245 WP_004454702.1.72468 WP_004454702.1.72483 WP_004454702.1.72560 WP_004454702.1.72682 WP_004454702.1.72891 WP_004454702.1.72909 WP_004454702.1.72914 WP_004454702.1.72994 WP_004454702.1.73026 WP_004454702.1.73116 WP_004454702.1.7322 WP_004454702.1.73852 WP_004454702.1.73931 WP_004454702.1.74116 WP_004454702.1.74126 WP_004454702.1.74672 WP_004454702.1.74678 WP_004454702.1.74680 WP_004454702.1.74835 WP_004454702.1.74897 WP_004454702.1.75026 WP_004454702.1.751 WP_004454702.1.75210 WP_004454702.1.75226 WP_004454702.1.75287 WP_004454702.1.75454 WP_004454702.1.75638 WP_004454702.1.75659 WP_004454702.1.76207 WP_004454702.1.7650 WP_004454702.1.76550 WP_004454702.1.76552 WP_004454702.1.76603 WP_004454702.1.76621 WP_004454702.1.76664 WP_004454702.1.76687 WP_004454702.1.76793 WP_004454702.1.76813 WP_004454702.1.76882 WP_004454702.1.76924 WP_004454702.1.7696 WP_004454702.1.77092 WP_004454702.1.77102 WP_004454702.1.77473 WP_004454702.1.77509 WP_004454702.1.77544 WP_004454702.1.7755 WP_004454702.1.77639 WP_004454702.1.77782 WP_004454702.1.77842 WP_004454702.1.77942 WP_004454702.1.78123 WP_004454702.1.78579 WP_004454702.1.78949 WP_004454702.1.7916 WP_004454702.1.79199 WP_004454702.1.79221 WP_004454702.1.79309 WP_004454702.1.79344 WP_004454702.1.79437 WP_004454702.1.79611 WP_004454702.1.79680 WP_004454702.1.79703 WP_004454702.1.79836 WP_004454702.1.79956 WP_004454702.1.80052 WP_004454702.1.80144 WP_004454702.1.80342 WP_004454702.1.80379 WP_004454702.1.80455 WP_004454702.1.80504 WP_004454702.1.80575 WP_004454702.1.80963 WP_004454702.1.81035 WP_004454702.1.81044 WP_004454702.1.81208 WP_004454702.1.81299 WP_004454702.1.81351 WP_004454702.1.81402 WP_004454702.1.81605 WP_004454702.1.81777 WP_004454702.1.82084 WP_004454702.1.82169 WP_004454702.1.82335 WP_004454702.1.82635 WP_004454702.1.82701 WP_004454702.1.82920 WP_004454702.1.8314 WP_004454702.1.83148 WP_004454702.1.83175 WP_004454702.1.83255 WP_004454702.1.83287 WP_004454702.1.83288 WP_004454702.1.83318 WP_004454702.1.83348 WP_004454702.1.834 WP_004454702.1.83477 WP_004454702.1.83515 WP_004454702.1.83822 WP_004454702.1.83918 WP_004454702.1.84253 WP_004454702.1.84528 WP_004454702.1.84646 WP_004454702.1.84843 WP_004454702.1.84880 WP_004454702.1.84923 WP_004454702.1.85020 WP_004454702.1.85127 WP_004454702.1.85214 WP_004454702.1.85219 WP_004454702.1.8527 WP_004454702.1.85420 WP_004454702.1.85442 WP_004454702.1.85454 WP_004454702.1.85776 WP_004454702.1.85863 WP_004454702.1.8587 WP_004454702.1.85874 WP_004454702.1.85932 WP_004454702.1.86008 WP_004454702.1.86011 WP_004454702.1.86049 WP_004454702.1.86088 WP_004454702.1.86094 WP_004454702.1.86116 WP_004454702.1.86117 WP_004454702.1.86328 WP_004454702.1.86395 WP_004454702.1.86534 WP_004454702.1.86743 WP_004454702.1.86767 WP_004454702.1.86837 WP_004454702.1.86914 WP_004454702.1.87058 WP_004454702.1.87195 WP_004454702.1.87326 WP_004454702.1.87454 WP_004454702.1.87714 WP_004454702.1.87723 WP_004454702.1.87730 WP_004454702.1.87918 WP_004454702.1.87932 WP_004454702.1.88091 WP_004454702.1.882 WP_004454702.1.88268 WP_004454702.1.88332 WP_004454702.1.88364 WP_004454702.1.88372 WP_004454702.1.88377 WP_004454702.1.88608 WP_004454702.1.88640 WP_004454702.1.88996 WP_004454702.1.89052 WP_004454702.1.89065 WP_004454702.1.89196 WP_004454702.1.89337 WP_004454702.1.89364 WP_004454702.1.89457 WP_004454702.1.89629 WP_004454702.1.89697 WP_004454702.1.89994 WP_004454702.1.90076 WP_004454702.1.90101 WP_004454702.1.90164 WP_004454702.1.90329 WP_004454702.1.9041 WP_004454702.1.90491 WP_004454702.1.90555 WP_004454702.1.90643 WP_004454702.1.9083 WP_004454702.1.90921 WP_004454702.1.90938 WP_004454702.1.91065 WP_004454702.1.91254 WP_004454702.1.91314 WP_004454702.1.91406 WP_004454702.1.91570 WP_004454702.1.91648 WP_004454702.1.92075 WP_004454702.1.92284 WP_004454702.1.92371 WP_004454702.1.92576 WP_004454702.1.92658 WP_004454702.1.92697 WP_004454702.1.92941 WP_004454702.1.93044 WP_004454702.1.93171 WP_004454702.1.93313 WP_004454702.1.93360 WP_004454702.1.93480 WP_004454702.1.93615 WP_004454702.1.93687 WP_004454702.1.93717 WP_004454702.1.93766 WP_004454702.1.93782 WP_004454702.1.93798 WP_004454702.1.93802 WP_004454702.1.93830 WP_004454702.1.9393 WP_004454702.1.94067 WP_004454702.1.94073 WP_004454702.1.94166 WP_004454702.1.94427 WP_004454702.1.94768 WP_004454702.1.94968 WP_004454702.1.95095 WP_004454702.1.95173 WP_004454702.1.9522 WP_004454702.1.95350 WP_004454702.1.95517 WP_004454702.1.9580 WP_004454702.1.95847 WP_004454702.1.95893 WP_004454702.1.96113 WP_004454702.1.9635 WP_004454702.1.96503 WP_004454702.1.96505 WP_004454702.1.9666 WP_004454702.1.96690 WP_004454702.1.96765 WP_004454702.1.97219 WP_004454702.1.97458 WP_004454702.1.97672 WP_004454702.1.97682 WP_004454702.1.97806 WP_004454702.1.98037 WP_004454702.1.98514 WP_004454702.1.98622 WP_004454702.1.98698 WP_004454702.1.98715 WP_004454702.1.98748 WP_004454702.1.98856 WP_004454702.1.98997 WP_004454702.1.99064 WP_004454702.1.99134 WP_004454702.1.99333 WP_004454702.1.99542 WP_004454702.1.99545 WP_004454702.1.99731 WP_004454702.1.9986 YP_001088917.1.32744 gi|260683983|ref|YP_003215268.1| 272563.CD2405 645462.CD196_2248 645463.CDR20291_2295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]