SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260684053|ref|YP_003215338.1| from Clostridium difficile CD196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260684053|ref|YP_003215338.1|
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.12e-21
Family Hypothetical protein PH1932 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|260684053|ref|YP_003215338.1|
Sequence length 173
Comment hypothetical protein CD196_2318 [Clostridium difficile CD196]
Sequence
MDIAKLILNPARLRILQYIRLHGSARTSDIVKYLNDIPRATVYHHVKILEENNMIEVIKE
NRVRGTIEKVYALKEYTTSMEGETFVALSTAFYVGLMQEMNEYFSRKEQDHKKDNVFFSS
ALLYMSDNEYENLLKSIADLLKPYIEQKPKSNLKLRKLSIISSPPVVDNDKTK
Download sequence
Identical sequences A0A0H3N5D5 A0A1F2DJ00 C9YP52
645462.CD196_2318 645463.CDR20291_2365 gi|384361696|ref|YP_006199548.1| gi|260687713|ref|YP_003218847.1| WP_009890684.1.100097 WP_009890684.1.100139 WP_009890684.1.10130 WP_009890684.1.10488 WP_009890684.1.11025 WP_009890684.1.12169 WP_009890684.1.1273 WP_009890684.1.12809 WP_009890684.1.13040 WP_009890684.1.13251 WP_009890684.1.13398 WP_009890684.1.14170 WP_009890684.1.14205 WP_009890684.1.1445 WP_009890684.1.14483 WP_009890684.1.14674 WP_009890684.1.16520 WP_009890684.1.16728 WP_009890684.1.16931 WP_009890684.1.17638 WP_009890684.1.17851 WP_009890684.1.17879 WP_009890684.1.17908 WP_009890684.1.18298 WP_009890684.1.18455 WP_009890684.1.18680 WP_009890684.1.19152 WP_009890684.1.19899 WP_009890684.1.20650 WP_009890684.1.20875 WP_009890684.1.21220 WP_009890684.1.21618 WP_009890684.1.22020 WP_009890684.1.22222 WP_009890684.1.22937 WP_009890684.1.2363 WP_009890684.1.26829 WP_009890684.1.2758 WP_009890684.1.27677 WP_009890684.1.27989 WP_009890684.1.2923 WP_009890684.1.2982 WP_009890684.1.303 WP_009890684.1.30519 WP_009890684.1.31160 WP_009890684.1.31183 WP_009890684.1.31351 WP_009890684.1.31385 WP_009890684.1.31742 WP_009890684.1.31960 WP_009890684.1.32119 WP_009890684.1.32230 WP_009890684.1.32699 WP_009890684.1.35181 WP_009890684.1.36338 WP_009890684.1.39525 WP_009890684.1.39876 WP_009890684.1.39975 WP_009890684.1.39981 WP_009890684.1.40522 WP_009890684.1.41342 WP_009890684.1.41534 WP_009890684.1.42664 WP_009890684.1.43663 WP_009890684.1.44471 WP_009890684.1.45165 WP_009890684.1.45257 WP_009890684.1.46066 WP_009890684.1.46522 WP_009890684.1.48279 WP_009890684.1.48935 WP_009890684.1.49339 WP_009890684.1.53044 WP_009890684.1.53704 WP_009890684.1.53710 WP_009890684.1.53729 WP_009890684.1.5423 WP_009890684.1.54262 WP_009890684.1.54692 WP_009890684.1.56217 WP_009890684.1.57711 WP_009890684.1.57827 WP_009890684.1.58323 WP_009890684.1.59588 WP_009890684.1.59707 WP_009890684.1.61492 WP_009890684.1.61972 WP_009890684.1.62637 WP_009890684.1.63248 WP_009890684.1.63581 WP_009890684.1.63599 WP_009890684.1.63853 WP_009890684.1.64197 WP_009890684.1.64447 WP_009890684.1.66119 WP_009890684.1.6675 WP_009890684.1.66888 WP_009890684.1.66900 WP_009890684.1.670 WP_009890684.1.6736 WP_009890684.1.67528 WP_009890684.1.68955 WP_009890684.1.6898 WP_009890684.1.69495 WP_009890684.1.700 WP_009890684.1.70152 WP_009890684.1.71745 WP_009890684.1.72682 WP_009890684.1.72909 WP_009890684.1.7322 WP_009890684.1.73931 WP_009890684.1.74116 WP_009890684.1.751 WP_009890684.1.7650 WP_009890684.1.76687 WP_009890684.1.76813 WP_009890684.1.7755 WP_009890684.1.77782 WP_009890684.1.79199 WP_009890684.1.79611 WP_009890684.1.81208 WP_009890684.1.82335 WP_009890684.1.83515 WP_009890684.1.84843 WP_009890684.1.84880 WP_009890684.1.8527 WP_009890684.1.86328 WP_009890684.1.86395 WP_009890684.1.86534 WP_009890684.1.87058 WP_009890684.1.87454 WP_009890684.1.87730 WP_009890684.1.87932 WP_009890684.1.88372 WP_009890684.1.88377 WP_009890684.1.89337 WP_009890684.1.90076 WP_009890684.1.9041 WP_009890684.1.91065 WP_009890684.1.91406 WP_009890684.1.92658 WP_009890684.1.92941 WP_009890684.1.93360 WP_009890684.1.9522 WP_009890684.1.9580 WP_009890684.1.96765 WP_009890684.1.98622 WP_009890684.1.98748 WP_009890684.1.99731 gi|260684053|ref|YP_003215338.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]