SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260684095|ref|YP_003215380.1| from Clostridium difficile CD196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260684095|ref|YP_003215380.1|
Domain Number 1 Region: 109-349,386-530
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.16e-45
Family AAT-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|260684095|ref|YP_003215380.1|
Sequence length 542
Comment aspartate aminotransferase [Clostridium difficile CD196]
Sequence
MKNHTYKEIKNIYGKISPFEFKDKLIDIAKYTAKENNRELLDAGRGNPNWTCSTAREAFF
TFGHFAITETRSNWDLGHLAGMPQKKGIKERFFKFINENIDMPGAYLARDIINFGINELG
FDGDEFVHELADGIIGDNYPLPDRMLPHMEKIVHDYLVQEMKYDISGKYGDVEIFAVEGA
TAAMCYIFDSLMANELLKKGDTIALMTPIFTPYLEIPNLPRYDFKVVNINANEVDEKGAH
TWQYTKKELEKLRDKSIKALFVVNPNNPASIAMDEISCNNLIDVIENYNKDLMIISDDVY
GTFVEDFSSLMSKLPYNTVGVYSYSKYFGVTGWRLGTFALHKKNVFDKKINDLTGELKKS
VDKRYSDMSLNPSSLSFMERVVADSRLVALNHTAGLSTPQQVQMAFFSAFALIDKVDAYK
KLNMSICHRRQKLLFEALELPINENKNNAAYYTQFDIEEWAKLNYGEDLFKFISKTASPV
DVLYKLANDYSVVLLSGNGFYGPEWSIRISLANLYDEAYTKIGKAIREILNGYIVEWQKI
KK
Download sequence
Identical sequences A0A0H3N9A7 A0A1F2DIW1 C9YP94
gi|384361738|ref|YP_006199590.1| 645462.CD196_2360 645463.CDR20291_2407 WP_009893631.1.100097 WP_009893631.1.100139 WP_009893631.1.10130 WP_009893631.1.10488 WP_009893631.1.11025 WP_009893631.1.12169 WP_009893631.1.1273 WP_009893631.1.12809 WP_009893631.1.13040 WP_009893631.1.13251 WP_009893631.1.13398 WP_009893631.1.14170 WP_009893631.1.14205 WP_009893631.1.1445 WP_009893631.1.14483 WP_009893631.1.14674 WP_009893631.1.15310 WP_009893631.1.16520 WP_009893631.1.16728 WP_009893631.1.16931 WP_009893631.1.17638 WP_009893631.1.17851 WP_009893631.1.17879 WP_009893631.1.17908 WP_009893631.1.18212 WP_009893631.1.18298 WP_009893631.1.18455 WP_009893631.1.18680 WP_009893631.1.19152 WP_009893631.1.19899 WP_009893631.1.20650 WP_009893631.1.20875 WP_009893631.1.21220 WP_009893631.1.21618 WP_009893631.1.22020 WP_009893631.1.22222 WP_009893631.1.22937 WP_009893631.1.2363 WP_009893631.1.2758 WP_009893631.1.27677 WP_009893631.1.27989 WP_009893631.1.2923 WP_009893631.1.2982 WP_009893631.1.303 WP_009893631.1.30519 WP_009893631.1.31160 WP_009893631.1.31183 WP_009893631.1.31351 WP_009893631.1.31385 WP_009893631.1.31475 WP_009893631.1.31742 WP_009893631.1.31960 WP_009893631.1.32119 WP_009893631.1.32230 WP_009893631.1.32699 WP_009893631.1.35181 WP_009893631.1.36338 WP_009893631.1.39525 WP_009893631.1.39876 WP_009893631.1.39975 WP_009893631.1.39981 WP_009893631.1.40522 WP_009893631.1.41342 WP_009893631.1.41534 WP_009893631.1.42664 WP_009893631.1.43663 WP_009893631.1.44471 WP_009893631.1.45165 WP_009893631.1.45257 WP_009893631.1.46066 WP_009893631.1.46522 WP_009893631.1.48279 WP_009893631.1.48935 WP_009893631.1.49339 WP_009893631.1.53044 WP_009893631.1.53704 WP_009893631.1.53710 WP_009893631.1.53729 WP_009893631.1.5423 WP_009893631.1.54262 WP_009893631.1.54692 WP_009893631.1.56217 WP_009893631.1.57711 WP_009893631.1.57827 WP_009893631.1.58323 WP_009893631.1.59588 WP_009893631.1.59707 WP_009893631.1.61492 WP_009893631.1.61679 WP_009893631.1.61972 WP_009893631.1.62637 WP_009893631.1.63248 WP_009893631.1.63581 WP_009893631.1.63599 WP_009893631.1.63853 WP_009893631.1.64197 WP_009893631.1.64447 WP_009893631.1.66119 WP_009893631.1.6675 WP_009893631.1.66888 WP_009893631.1.66900 WP_009893631.1.670 WP_009893631.1.6736 WP_009893631.1.67528 WP_009893631.1.67695 WP_009893631.1.68955 WP_009893631.1.6898 WP_009893631.1.69495 WP_009893631.1.700 WP_009893631.1.70152 WP_009893631.1.71745 WP_009893631.1.72682 WP_009893631.1.72909 WP_009893631.1.7322 WP_009893631.1.73931 WP_009893631.1.74116 WP_009893631.1.74680 WP_009893631.1.751 WP_009893631.1.7650 WP_009893631.1.76687 WP_009893631.1.76813 WP_009893631.1.7755 WP_009893631.1.77782 WP_009893631.1.79199 WP_009893631.1.79611 WP_009893631.1.81208 WP_009893631.1.82335 WP_009893631.1.83515 WP_009893631.1.84843 WP_009893631.1.84880 WP_009893631.1.8527 WP_009893631.1.86328 WP_009893631.1.86534 WP_009893631.1.87058 WP_009893631.1.87454 WP_009893631.1.87730 WP_009893631.1.87932 WP_009893631.1.88372 WP_009893631.1.88377 WP_009893631.1.89337 WP_009893631.1.90076 WP_009893631.1.9041 WP_009893631.1.91065 WP_009893631.1.91406 WP_009893631.1.92658 WP_009893631.1.92941 WP_009893631.1.93360 WP_009893631.1.9522 WP_009893631.1.9580 WP_009893631.1.96765 WP_009893631.1.98622 WP_009893631.1.98748 WP_009893631.1.99731 gi|260687754|ref|YP_003218888.1| gi|260684095|ref|YP_003215380.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]