SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260684333|ref|YP_003215618.1| from Clostridium difficile CD196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260684333|ref|YP_003215618.1|
Domain Number 1 Region: 1-131
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000519
Family Plant O-methyltransferase, N-terminal domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|260684333|ref|YP_003215618.1|
Sequence length 132
Comment hypothetical protein CD196_2600 [Clostridium difficile CD196]
Sequence
MISEDVDYSIRIIRAIFNNGEDKPIDAKMILKSEDIPILTLYRLLRKLCANNILTFNKED
GKTYMLNVSLDTISLRTIVEVIDGKIYINKCTRYVSNCSNCLKGCKVNRELLEIEKEIYK
LLSRKSIRQILE
Download sequence
Identical sequences A0A031WF47 A0A0H3N674 A0A0J0UDD0 A0A125V9D1 A0A1F2DG93 C9YPY2 G6B4I5 G6BF71 Q183J6 T4HB55
gi|126700375|ref|YP_001089272.1| gi|260687992|ref|YP_003219126.1| 272563.CD2759 645462.CD196_2600 645463.CDR20291_2647 gi|384361977|ref|YP_006199829.1| 396892 gi|260684333|ref|YP_003215618.1| WP_003426473.1.100055 WP_003426473.1.100097 WP_003426473.1.100099 WP_003426473.1.100107 WP_003426473.1.100118 WP_003426473.1.100139 WP_003426473.1.100513 WP_003426473.1.100570 WP_003426473.1.100660 WP_003426473.1.100831 WP_003426473.1.100923 WP_003426473.1.101035 WP_003426473.1.101125 WP_003426473.1.101279 WP_003426473.1.10130 WP_003426473.1.101316 WP_003426473.1.101532 WP_003426473.1.101861 WP_003426473.1.101929 WP_003426473.1.102031 WP_003426473.1.102074 WP_003426473.1.102095 WP_003426473.1.10483 WP_003426473.1.10488 WP_003426473.1.10582 WP_003426473.1.10691 WP_003426473.1.10793 WP_003426473.1.11025 WP_003426473.1.11224 WP_003426473.1.11278 WP_003426473.1.11320 WP_003426473.1.11398 WP_003426473.1.1167 WP_003426473.1.1179 WP_003426473.1.11937 WP_003426473.1.11954 WP_003426473.1.11959 WP_003426473.1.12066 WP_003426473.1.12169 WP_003426473.1.12385 WP_003426473.1.1254 WP_003426473.1.12629 WP_003426473.1.12632 WP_003426473.1.12659 WP_003426473.1.1273 WP_003426473.1.12734 WP_003426473.1.12807 WP_003426473.1.12809 WP_003426473.1.12953 WP_003426473.1.13040 WP_003426473.1.13251 WP_003426473.1.13273 WP_003426473.1.13398 WP_003426473.1.13418 WP_003426473.1.13730 WP_003426473.1.13841 WP_003426473.1.13859 WP_003426473.1.14045 WP_003426473.1.141 WP_003426473.1.14170 WP_003426473.1.14177 WP_003426473.1.14205 WP_003426473.1.1422 WP_003426473.1.14259 WP_003426473.1.14330 WP_003426473.1.14352 WP_003426473.1.1445 WP_003426473.1.14457 WP_003426473.1.14483 WP_003426473.1.14579 WP_003426473.1.14674 WP_003426473.1.14686 WP_003426473.1.14698 WP_003426473.1.14848 WP_003426473.1.1494 WP_003426473.1.15083 WP_003426473.1.15097 WP_003426473.1.15192 WP_003426473.1.15205 WP_003426473.1.15310 WP_003426473.1.15435 WP_003426473.1.15908 WP_003426473.1.16012 WP_003426473.1.16135 WP_003426473.1.16185 WP_003426473.1.16376 WP_003426473.1.16520 WP_003426473.1.16728 WP_003426473.1.16897 WP_003426473.1.169 WP_003426473.1.16931 WP_003426473.1.16966 WP_003426473.1.1705 WP_003426473.1.17371 WP_003426473.1.17413 WP_003426473.1.17463 WP_003426473.1.17512 WP_003426473.1.17611 WP_003426473.1.17638 WP_003426473.1.17851 WP_003426473.1.17879 WP_003426473.1.17908 WP_003426473.1.17960 WP_003426473.1.18060 WP_003426473.1.18207 WP_003426473.1.18212 WP_003426473.1.18298 WP_003426473.1.1838 WP_003426473.1.18407 WP_003426473.1.18455 WP_003426473.1.18462 WP_003426473.1.18680 WP_003426473.1.18805 WP_003426473.1.18970 WP_003426473.1.19088 WP_003426473.1.19152 WP_003426473.1.1926 WP_003426473.1.19290 WP_003426473.1.1934 WP_003426473.1.19648 WP_003426473.1.19704 WP_003426473.1.19899 WP_003426473.1.19956 WP_003426473.1.1999 WP_003426473.1.2002 WP_003426473.1.20132 WP_003426473.1.20184 WP_003426473.1.20302 WP_003426473.1.20313 WP_003426473.1.20481 WP_003426473.1.20650 WP_003426473.1.20728 WP_003426473.1.20872 WP_003426473.1.20875 WP_003426473.1.20960 WP_003426473.1.21000 WP_003426473.1.21048 WP_003426473.1.21201 WP_003426473.1.21220 WP_003426473.1.21417 WP_003426473.1.21502 WP_003426473.1.21520 WP_003426473.1.21547 WP_003426473.1.21618 WP_003426473.1.21704 WP_003426473.1.21893 WP_003426473.1.22020 WP_003426473.1.22079 WP_003426473.1.22128 WP_003426473.1.22222 WP_003426473.1.22228 WP_003426473.1.22313 WP_003426473.1.22357 WP_003426473.1.22411 WP_003426473.1.22417 WP_003426473.1.22568 WP_003426473.1.22569 WP_003426473.1.22615 WP_003426473.1.22768 WP_003426473.1.22893 WP_003426473.1.22937 WP_003426473.1.23096 WP_003426473.1.23208 WP_003426473.1.23287 WP_003426473.1.23338 WP_003426473.1.2363 WP_003426473.1.24197 WP_003426473.1.24457 WP_003426473.1.24520 WP_003426473.1.24826 WP_003426473.1.24889 WP_003426473.1.24900 WP_003426473.1.24987 WP_003426473.1.25128 WP_003426473.1.25416 WP_003426473.1.25761 WP_003426473.1.26044 WP_003426473.1.26358 WP_003426473.1.26482 WP_003426473.1.26494 WP_003426473.1.26697 WP_003426473.1.26829 WP_003426473.1.26940 WP_003426473.1.2758 WP_003426473.1.27677 WP_003426473.1.27708 WP_003426473.1.27824 WP_003426473.1.27872 WP_003426473.1.27881 WP_003426473.1.27890 WP_003426473.1.27967 WP_003426473.1.27989 WP_003426473.1.27996 WP_003426473.1.28055 WP_003426473.1.28410 WP_003426473.1.28638 WP_003426473.1.28715 WP_003426473.1.28856 WP_003426473.1.28882 WP_003426473.1.28890 WP_003426473.1.28930 WP_003426473.1.2923 WP_003426473.1.293 WP_003426473.1.29600 WP_003426473.1.29757 WP_003426473.1.2982 WP_003426473.1.29891 WP_003426473.1.3024 WP_003426473.1.303 WP_003426473.1.30420 WP_003426473.1.30431 WP_003426473.1.30463 WP_003426473.1.30519 WP_003426473.1.30521 WP_003426473.1.30743 WP_003426473.1.30841 WP_003426473.1.30953 WP_003426473.1.31160 WP_003426473.1.31183 WP_003426473.1.31203 WP_003426473.1.31292 WP_003426473.1.31309 WP_003426473.1.31351 WP_003426473.1.31385 WP_003426473.1.31453 WP_003426473.1.31475 WP_003426473.1.31477 WP_003426473.1.31519 WP_003426473.1.31637 WP_003426473.1.31719 WP_003426473.1.31742 WP_003426473.1.31960 WP_003426473.1.31969 WP_003426473.1.32008 WP_003426473.1.32066 WP_003426473.1.32119 WP_003426473.1.32166 WP_003426473.1.32197 WP_003426473.1.32218 WP_003426473.1.32230 WP_003426473.1.32294 WP_003426473.1.32699 WP_003426473.1.32769 WP_003426473.1.32776 WP_003426473.1.32842 WP_003426473.1.33056 WP_003426473.1.33098 WP_003426473.1.33164 WP_003426473.1.33298 WP_003426473.1.33332 WP_003426473.1.33349 WP_003426473.1.3340 WP_003426473.1.33514 WP_003426473.1.33810 WP_003426473.1.34388 WP_003426473.1.34489 WP_003426473.1.34545 WP_003426473.1.34641 WP_003426473.1.34800 WP_003426473.1.34985 WP_003426473.1.34989 WP_003426473.1.35 WP_003426473.1.35137 WP_003426473.1.35181 WP_003426473.1.35187 WP_003426473.1.35234 WP_003426473.1.3559 WP_003426473.1.35832 WP_003426473.1.35884 WP_003426473.1.36078 WP_003426473.1.36257 WP_003426473.1.36338 WP_003426473.1.36738 WP_003426473.1.36835 WP_003426473.1.37255 WP_003426473.1.374 WP_003426473.1.37493 WP_003426473.1.37532 WP_003426473.1.37597 WP_003426473.1.37861 WP_003426473.1.3789 WP_003426473.1.37957 WP_003426473.1.37981 WP_003426473.1.38305 WP_003426473.1.38338 WP_003426473.1.38692 WP_003426473.1.38775 WP_003426473.1.38814 WP_003426473.1.38874 WP_003426473.1.38924 WP_003426473.1.38986 WP_003426473.1.3913 WP_003426473.1.39213 WP_003426473.1.39350 WP_003426473.1.39382 WP_003426473.1.39442 WP_003426473.1.39525 WP_003426473.1.39621 WP_003426473.1.39783 WP_003426473.1.39874 WP_003426473.1.39876 WP_003426473.1.39975 WP_003426473.1.39981 WP_003426473.1.40030 WP_003426473.1.40294 WP_003426473.1.40313 WP_003426473.1.40447 WP_003426473.1.40522 WP_003426473.1.40557 WP_003426473.1.407 WP_003426473.1.40775 WP_003426473.1.40891 WP_003426473.1.40959 WP_003426473.1.40966 WP_003426473.1.41131 WP_003426473.1.4121 WP_003426473.1.41334 WP_003426473.1.41342 WP_003426473.1.4137 WP_003426473.1.41506 WP_003426473.1.41534 WP_003426473.1.41641 WP_003426473.1.41687 WP_003426473.1.41818 WP_003426473.1.41995 WP_003426473.1.42035 WP_003426473.1.4204 WP_003426473.1.42532 WP_003426473.1.42533 WP_003426473.1.42610 WP_003426473.1.42664 WP_003426473.1.43112 WP_003426473.1.4315 WP_003426473.1.4321 WP_003426473.1.43388 WP_003426473.1.43490 WP_003426473.1.43519 WP_003426473.1.43579 WP_003426473.1.43824 WP_003426473.1.4383 WP_003426473.1.44030 WP_003426473.1.44105 WP_003426473.1.44149 WP_003426473.1.44198 WP_003426473.1.44241 WP_003426473.1.44470 WP_003426473.1.44471 WP_003426473.1.44729 WP_003426473.1.45017 WP_003426473.1.45059 WP_003426473.1.45142 WP_003426473.1.45165 WP_003426473.1.45209 WP_003426473.1.45257 WP_003426473.1.45352 WP_003426473.1.45554 WP_003426473.1.4573 WP_003426473.1.45938 WP_003426473.1.45986 WP_003426473.1.46066 WP_003426473.1.46274 WP_003426473.1.46280 WP_003426473.1.46305 WP_003426473.1.46522 WP_003426473.1.4698 WP_003426473.1.47016 WP_003426473.1.47121 WP_003426473.1.47227 WP_003426473.1.47228 WP_003426473.1.47479 WP_003426473.1.47615 WP_003426473.1.47708 WP_003426473.1.47729 WP_003426473.1.47940 WP_003426473.1.48246 WP_003426473.1.48279 WP_003426473.1.4835 WP_003426473.1.48746 WP_003426473.1.48772 WP_003426473.1.48935 WP_003426473.1.48980 WP_003426473.1.48983 WP_003426473.1.48991 WP_003426473.1.49054 WP_003426473.1.49065 WP_003426473.1.4908 WP_003426473.1.49092 WP_003426473.1.49230 WP_003426473.1.49310 WP_003426473.1.49339 WP_003426473.1.4948 WP_003426473.1.49633 WP_003426473.1.50159 WP_003426473.1.50341 WP_003426473.1.50460 WP_003426473.1.5073 WP_003426473.1.50865 WP_003426473.1.51007 WP_003426473.1.51235 WP_003426473.1.51675 WP_003426473.1.5187 WP_003426473.1.51996 WP_003426473.1.52073 WP_003426473.1.52266 WP_003426473.1.52278 WP_003426473.1.52294 WP_003426473.1.52311 WP_003426473.1.52330 WP_003426473.1.52383 WP_003426473.1.52402 WP_003426473.1.52466 WP_003426473.1.52525 WP_003426473.1.52789 WP_003426473.1.52958 WP_003426473.1.52997 WP_003426473.1.53008 WP_003426473.1.53044 WP_003426473.1.53055 WP_003426473.1.5337 WP_003426473.1.53504 WP_003426473.1.53704 WP_003426473.1.53710 WP_003426473.1.53729 WP_003426473.1.53987 WP_003426473.1.54058 WP_003426473.1.54153 WP_003426473.1.5423 WP_003426473.1.54262 WP_003426473.1.54350 WP_003426473.1.54586 WP_003426473.1.54593 WP_003426473.1.54692 WP_003426473.1.55055 WP_003426473.1.55101 WP_003426473.1.5521 WP_003426473.1.55302 WP_003426473.1.55371 WP_003426473.1.55391 WP_003426473.1.5558 WP_003426473.1.559 WP_003426473.1.56006 WP_003426473.1.56217 WP_003426473.1.56252 WP_003426473.1.56323 WP_003426473.1.56337 WP_003426473.1.56556 WP_003426473.1.5657 WP_003426473.1.5664 WP_003426473.1.56664 WP_003426473.1.56711 WP_003426473.1.56754 WP_003426473.1.56927 WP_003426473.1.56998 WP_003426473.1.57099 WP_003426473.1.57337 WP_003426473.1.5750 WP_003426473.1.57711 WP_003426473.1.57827 WP_003426473.1.58015 WP_003426473.1.58216 WP_003426473.1.58304 WP_003426473.1.58315 WP_003426473.1.58323 WP_003426473.1.58463 WP_003426473.1.58531 WP_003426473.1.58665 WP_003426473.1.58677 WP_003426473.1.58711 WP_003426473.1.58818 WP_003426473.1.58956 WP_003426473.1.59032 WP_003426473.1.5905 WP_003426473.1.59588 WP_003426473.1.59618 WP_003426473.1.59628 WP_003426473.1.59707 WP_003426473.1.59752 WP_003426473.1.59990 WP_003426473.1.60040 WP_003426473.1.6031 WP_003426473.1.60482 WP_003426473.1.60563 WP_003426473.1.6070 WP_003426473.1.60957 WP_003426473.1.60998 WP_003426473.1.61042 WP_003426473.1.61140 WP_003426473.1.61492 WP_003426473.1.61679 WP_003426473.1.61716 WP_003426473.1.61866 WP_003426473.1.61972 WP_003426473.1.62049 WP_003426473.1.62095 WP_003426473.1.62128 WP_003426473.1.62340 WP_003426473.1.62577 WP_003426473.1.62624 WP_003426473.1.62637 WP_003426473.1.62986 WP_003426473.1.63020 WP_003426473.1.63059 WP_003426473.1.63237 WP_003426473.1.63239 WP_003426473.1.63248 WP_003426473.1.63343 WP_003426473.1.63378 WP_003426473.1.63516 WP_003426473.1.63570 WP_003426473.1.63581 WP_003426473.1.63598 WP_003426473.1.63599 WP_003426473.1.63696 WP_003426473.1.63804 WP_003426473.1.64020 WP_003426473.1.64092 WP_003426473.1.64197 WP_003426473.1.64369 WP_003426473.1.64447 WP_003426473.1.64546 WP_003426473.1.64573 WP_003426473.1.64859 WP_003426473.1.65067 WP_003426473.1.65369 WP_003426473.1.65889 WP_003426473.1.66084 WP_003426473.1.66119 WP_003426473.1.66237 WP_003426473.1.66439 WP_003426473.1.66474 WP_003426473.1.66565 WP_003426473.1.66587 WP_003426473.1.66643 WP_003426473.1.6671 WP_003426473.1.6675 WP_003426473.1.66805 WP_003426473.1.66847 WP_003426473.1.6685 WP_003426473.1.66887 WP_003426473.1.66888 WP_003426473.1.66900 WP_003426473.1.670 WP_003426473.1.67308 WP_003426473.1.6736 WP_003426473.1.67368 WP_003426473.1.67528 WP_003426473.1.67689 WP_003426473.1.67695 WP_003426473.1.67711 WP_003426473.1.6792 WP_003426473.1.67951 WP_003426473.1.68150 WP_003426473.1.68276 WP_003426473.1.68322 WP_003426473.1.68955 WP_003426473.1.6898 WP_003426473.1.68980 WP_003426473.1.69114 WP_003426473.1.692 WP_003426473.1.69220 WP_003426473.1.69333 WP_003426473.1.69495 WP_003426473.1.69708 WP_003426473.1.6994 WP_003426473.1.700 WP_003426473.1.70152 WP_003426473.1.70179 WP_003426473.1.70231 WP_003426473.1.70320 WP_003426473.1.70695 WP_003426473.1.70710 WP_003426473.1.70820 WP_003426473.1.70886 WP_003426473.1.71079 WP_003426473.1.71119 WP_003426473.1.713 WP_003426473.1.71384 WP_003426473.1.71477 WP_003426473.1.7156 WP_003426473.1.71745 WP_003426473.1.7199 WP_003426473.1.72113 WP_003426473.1.72245 WP_003426473.1.72468 WP_003426473.1.72483 WP_003426473.1.72560 WP_003426473.1.72681 WP_003426473.1.72682 WP_003426473.1.72891 WP_003426473.1.72909 WP_003426473.1.72914 WP_003426473.1.72994 WP_003426473.1.73026 WP_003426473.1.73116 WP_003426473.1.7322 WP_003426473.1.73605 WP_003426473.1.73852 WP_003426473.1.73931 WP_003426473.1.74050 WP_003426473.1.74116 WP_003426473.1.74126 WP_003426473.1.74672 WP_003426473.1.74678 WP_003426473.1.74680 WP_003426473.1.74835 WP_003426473.1.74897 WP_003426473.1.75026 WP_003426473.1.751 WP_003426473.1.75210 WP_003426473.1.75226 WP_003426473.1.75287 WP_003426473.1.75454 WP_003426473.1.75638 WP_003426473.1.75659 WP_003426473.1.76207 WP_003426473.1.7650 WP_003426473.1.76550 WP_003426473.1.76552 WP_003426473.1.76603 WP_003426473.1.76621 WP_003426473.1.76664 WP_003426473.1.76687 WP_003426473.1.76813 WP_003426473.1.76882 WP_003426473.1.76924 WP_003426473.1.7696 WP_003426473.1.77092 WP_003426473.1.77102 WP_003426473.1.77473 WP_003426473.1.77509 WP_003426473.1.77544 WP_003426473.1.7755 WP_003426473.1.77639 WP_003426473.1.77782 WP_003426473.1.77842 WP_003426473.1.77942 WP_003426473.1.78123 WP_003426473.1.78579 WP_003426473.1.78949 WP_003426473.1.7916 WP_003426473.1.79199 WP_003426473.1.79221 WP_003426473.1.79309 WP_003426473.1.79344 WP_003426473.1.79437 WP_003426473.1.79611 WP_003426473.1.79680 WP_003426473.1.79703 WP_003426473.1.79836 WP_003426473.1.79956 WP_003426473.1.80052 WP_003426473.1.80144 WP_003426473.1.80342 WP_003426473.1.80379 WP_003426473.1.80455 WP_003426473.1.80504 WP_003426473.1.80575 WP_003426473.1.80963 WP_003426473.1.81035 WP_003426473.1.81044 WP_003426473.1.81208 WP_003426473.1.81299 WP_003426473.1.81351 WP_003426473.1.81402 WP_003426473.1.81605 WP_003426473.1.81777 WP_003426473.1.82002 WP_003426473.1.82084 WP_003426473.1.82150 WP_003426473.1.82169 WP_003426473.1.82335 WP_003426473.1.82635 WP_003426473.1.82701 WP_003426473.1.82920 WP_003426473.1.8314 WP_003426473.1.83148 WP_003426473.1.83175 WP_003426473.1.83255 WP_003426473.1.83287 WP_003426473.1.83288 WP_003426473.1.83318 WP_003426473.1.83348 WP_003426473.1.834 WP_003426473.1.83477 WP_003426473.1.83515 WP_003426473.1.83822 WP_003426473.1.83918 WP_003426473.1.84253 WP_003426473.1.84528 WP_003426473.1.84646 WP_003426473.1.84843 WP_003426473.1.84880 WP_003426473.1.84923 WP_003426473.1.85020 WP_003426473.1.85127 WP_003426473.1.85214 WP_003426473.1.85219 WP_003426473.1.8527 WP_003426473.1.85420 WP_003426473.1.85454 WP_003426473.1.85776 WP_003426473.1.85863 WP_003426473.1.8587 WP_003426473.1.85874 WP_003426473.1.85932 WP_003426473.1.86008 WP_003426473.1.86011 WP_003426473.1.86049 WP_003426473.1.86088 WP_003426473.1.86094 WP_003426473.1.86116 WP_003426473.1.86117 WP_003426473.1.86328 WP_003426473.1.86395 WP_003426473.1.86534 WP_003426473.1.86618 WP_003426473.1.86743 WP_003426473.1.86767 WP_003426473.1.86837 WP_003426473.1.86914 WP_003426473.1.87058 WP_003426473.1.87195 WP_003426473.1.87326 WP_003426473.1.87454 WP_003426473.1.87714 WP_003426473.1.87723 WP_003426473.1.87730 WP_003426473.1.87918 WP_003426473.1.87932 WP_003426473.1.88091 WP_003426473.1.882 WP_003426473.1.88268 WP_003426473.1.88332 WP_003426473.1.88364 WP_003426473.1.88372 WP_003426473.1.88377 WP_003426473.1.88608 WP_003426473.1.88640 WP_003426473.1.88996 WP_003426473.1.89052 WP_003426473.1.89065 WP_003426473.1.89196 WP_003426473.1.89337 WP_003426473.1.89364 WP_003426473.1.89457 WP_003426473.1.89541 WP_003426473.1.89629 WP_003426473.1.89697 WP_003426473.1.89994 WP_003426473.1.90076 WP_003426473.1.90101 WP_003426473.1.90164 WP_003426473.1.90329 WP_003426473.1.9041 WP_003426473.1.90491 WP_003426473.1.90555 WP_003426473.1.90643 WP_003426473.1.9083 WP_003426473.1.90921 WP_003426473.1.90938 WP_003426473.1.90981 WP_003426473.1.91065 WP_003426473.1.91254 WP_003426473.1.91314 WP_003426473.1.91406 WP_003426473.1.91570 WP_003426473.1.91648 WP_003426473.1.92075 WP_003426473.1.92284 WP_003426473.1.92371 WP_003426473.1.92576 WP_003426473.1.92658 WP_003426473.1.92697 WP_003426473.1.92941 WP_003426473.1.93044 WP_003426473.1.93171 WP_003426473.1.93313 WP_003426473.1.93360 WP_003426473.1.93480 WP_003426473.1.93615 WP_003426473.1.93687 WP_003426473.1.93717 WP_003426473.1.93766 WP_003426473.1.93782 WP_003426473.1.93798 WP_003426473.1.93802 WP_003426473.1.93830 WP_003426473.1.9393 WP_003426473.1.94067 WP_003426473.1.94073 WP_003426473.1.94166 WP_003426473.1.94427 WP_003426473.1.94768 WP_003426473.1.94831 WP_003426473.1.94968 WP_003426473.1.95095 WP_003426473.1.95173 WP_003426473.1.9522 WP_003426473.1.95350 WP_003426473.1.95517 WP_003426473.1.9580 WP_003426473.1.95847 WP_003426473.1.95893 WP_003426473.1.96113 WP_003426473.1.9635 WP_003426473.1.96503 WP_003426473.1.96505 WP_003426473.1.9666 WP_003426473.1.96690 WP_003426473.1.96765 WP_003426473.1.97219 WP_003426473.1.97458 WP_003426473.1.97672 WP_003426473.1.97682 WP_003426473.1.97806 WP_003426473.1.98037 WP_003426473.1.98514 WP_003426473.1.98622 WP_003426473.1.98698 WP_003426473.1.98715 WP_003426473.1.98748 WP_003426473.1.98856 WP_003426473.1.98913 WP_003426473.1.98997 WP_003426473.1.99064 WP_003426473.1.99134 WP_003426473.1.99333 WP_003426473.1.99542 WP_003426473.1.99545 WP_003426473.1.99731 WP_003426473.1.9986 YP_001089272.1.32744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]