SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260684404|ref|YP_003215689.1| from Clostridium difficile CD196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260684404|ref|YP_003215689.1|
Domain Number 1 Region: 10-138
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.44e-26
Family MarR-like transcriptional regulators 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|260684404|ref|YP_003215689.1|
Sequence length 148
Comment MarR family transcriptional regulator [Clostridium difficile CD196]
Sequence
MDFKNLQYESLSYIICNLQKNFKLYCEKCLKPYKLTNGLYFYLIYINKNRNCSLNDVSTE
FEVDKAHTTRTISRLEQDGYIEKIQNPNDSRAFQLRVTDKGEEVLGDIKNIFSKWDNHIK
KEFSDTEYKELVKNLHVVKDIKTAVEEG
Download sequence
Identical sequences A0A0H3N545 A0A1F2CRR9 C9YQ53
645462.CD196_2671 645463.CDR20291_2718 gi|260688063|ref|YP_003219197.1| gi|260684404|ref|YP_003215689.1| gi|384362050|ref|YP_006199902.1| WP_009891114.1.100097 WP_009891114.1.100139 WP_009891114.1.10130 WP_009891114.1.10488 WP_009891114.1.11025 WP_009891114.1.12169 WP_009891114.1.1273 WP_009891114.1.12809 WP_009891114.1.13040 WP_009891114.1.13251 WP_009891114.1.13398 WP_009891114.1.14170 WP_009891114.1.14205 WP_009891114.1.1445 WP_009891114.1.14483 WP_009891114.1.16520 WP_009891114.1.16728 WP_009891114.1.16931 WP_009891114.1.17851 WP_009891114.1.17879 WP_009891114.1.17908 WP_009891114.1.18212 WP_009891114.1.18298 WP_009891114.1.18455 WP_009891114.1.18680 WP_009891114.1.19152 WP_009891114.1.19899 WP_009891114.1.20650 WP_009891114.1.20875 WP_009891114.1.21220 WP_009891114.1.21618 WP_009891114.1.22020 WP_009891114.1.22222 WP_009891114.1.22937 WP_009891114.1.2363 WP_009891114.1.26829 WP_009891114.1.27677 WP_009891114.1.27989 WP_009891114.1.2923 WP_009891114.1.2982 WP_009891114.1.303 WP_009891114.1.30519 WP_009891114.1.31160 WP_009891114.1.31183 WP_009891114.1.31351 WP_009891114.1.31385 WP_009891114.1.31475 WP_009891114.1.31742 WP_009891114.1.31960 WP_009891114.1.32119 WP_009891114.1.32230 WP_009891114.1.32699 WP_009891114.1.35181 WP_009891114.1.36338 WP_009891114.1.39525 WP_009891114.1.39876 WP_009891114.1.39975 WP_009891114.1.39981 WP_009891114.1.40522 WP_009891114.1.41342 WP_009891114.1.41534 WP_009891114.1.42664 WP_009891114.1.44471 WP_009891114.1.45165 WP_009891114.1.45257 WP_009891114.1.46066 WP_009891114.1.46522 WP_009891114.1.48279 WP_009891114.1.48935 WP_009891114.1.53044 WP_009891114.1.53704 WP_009891114.1.53710 WP_009891114.1.53729 WP_009891114.1.5423 WP_009891114.1.54262 WP_009891114.1.54692 WP_009891114.1.57711 WP_009891114.1.57827 WP_009891114.1.58323 WP_009891114.1.59588 WP_009891114.1.59707 WP_009891114.1.61492 WP_009891114.1.61679 WP_009891114.1.61972 WP_009891114.1.62637 WP_009891114.1.63248 WP_009891114.1.63581 WP_009891114.1.63599 WP_009891114.1.63853 WP_009891114.1.64197 WP_009891114.1.64447 WP_009891114.1.66119 WP_009891114.1.6675 WP_009891114.1.66888 WP_009891114.1.66900 WP_009891114.1.670 WP_009891114.1.6736 WP_009891114.1.67528 WP_009891114.1.68955 WP_009891114.1.6898 WP_009891114.1.69495 WP_009891114.1.700 WP_009891114.1.70152 WP_009891114.1.71745 WP_009891114.1.72682 WP_009891114.1.72909 WP_009891114.1.7322 WP_009891114.1.73931 WP_009891114.1.74116 WP_009891114.1.74680 WP_009891114.1.751 WP_009891114.1.7650 WP_009891114.1.76687 WP_009891114.1.76813 WP_009891114.1.7755 WP_009891114.1.77782 WP_009891114.1.79199 WP_009891114.1.79611 WP_009891114.1.81208 WP_009891114.1.82335 WP_009891114.1.83515 WP_009891114.1.84843 WP_009891114.1.84880 WP_009891114.1.8527 WP_009891114.1.86328 WP_009891114.1.86395 WP_009891114.1.86534 WP_009891114.1.87058 WP_009891114.1.87454 WP_009891114.1.87730 WP_009891114.1.87932 WP_009891114.1.88372 WP_009891114.1.88377 WP_009891114.1.89337 WP_009891114.1.90076 WP_009891114.1.9041 WP_009891114.1.91065 WP_009891114.1.91406 WP_009891114.1.92658 WP_009891114.1.92941 WP_009891114.1.93360 WP_009891114.1.9522 WP_009891114.1.96765 WP_009891114.1.98622 WP_009891114.1.98748 WP_009891114.1.99731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]