SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260684421|ref|YP_003215706.1| from Clostridium difficile CD196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260684421|ref|YP_003215706.1|
Domain Number 1 Region: 6-143
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.29e-25
Family MarR-like transcriptional regulators 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|260684421|ref|YP_003215706.1|
Sequence length 145
Comment MarR family transcriptional regulator [Clostridium difficile CD196]
Sequence
MEDKYIVHFISKTKASMIKFIENKLSKNGLGELIPTHGNILTALYENNGILTMKEIAAKI
GKDKSTVTVLVNKLINLGYLERQKCTNDKRITYIKLTKKALLIEDTFNSISTQVKETAYH
NITENEKQEFLRILKKINDNFKNAD
Download sequence
Identical sequences A0A031WJP5 A0A0H3N5A0 A0A125V954 A0A1F2CSC5 C9YQ70 Q183T5 T4H8K2
gi|126700460|ref|YP_001089357.1| 272563.CD2844 645462.CD196_2688 645463.CDR20291_2735 gi|384362068|ref|YP_006199920.1| gi|260684421|ref|YP_003215706.1| WP_003436793.1.100055 WP_003436793.1.100097 WP_003436793.1.100107 WP_003436793.1.100118 WP_003436793.1.100139 WP_003436793.1.100513 WP_003436793.1.100570 WP_003436793.1.100660 WP_003436793.1.100831 WP_003436793.1.101035 WP_003436793.1.101125 WP_003436793.1.101279 WP_003436793.1.10130 WP_003436793.1.101316 WP_003436793.1.101532 WP_003436793.1.101861 WP_003436793.1.102031 WP_003436793.1.102074 WP_003436793.1.102095 WP_003436793.1.10483 WP_003436793.1.10488 WP_003436793.1.10582 WP_003436793.1.10691 WP_003436793.1.10793 WP_003436793.1.10795 WP_003436793.1.11025 WP_003436793.1.11224 WP_003436793.1.11278 WP_003436793.1.11320 WP_003436793.1.11398 WP_003436793.1.1167 WP_003436793.1.1179 WP_003436793.1.11937 WP_003436793.1.11959 WP_003436793.1.12066 WP_003436793.1.12169 WP_003436793.1.12385 WP_003436793.1.1254 WP_003436793.1.12629 WP_003436793.1.12632 WP_003436793.1.12659 WP_003436793.1.1273 WP_003436793.1.12734 WP_003436793.1.12807 WP_003436793.1.12809 WP_003436793.1.13040 WP_003436793.1.13251 WP_003436793.1.13273 WP_003436793.1.13398 WP_003436793.1.13418 WP_003436793.1.13730 WP_003436793.1.13841 WP_003436793.1.13859 WP_003436793.1.14045 WP_003436793.1.141 WP_003436793.1.14170 WP_003436793.1.14177 WP_003436793.1.14205 WP_003436793.1.1422 WP_003436793.1.14259 WP_003436793.1.14330 WP_003436793.1.14352 WP_003436793.1.1445 WP_003436793.1.14457 WP_003436793.1.14483 WP_003436793.1.14579 WP_003436793.1.14674 WP_003436793.1.14686 WP_003436793.1.14698 WP_003436793.1.14848 WP_003436793.1.1494 WP_003436793.1.15083 WP_003436793.1.15097 WP_003436793.1.15192 WP_003436793.1.15205 WP_003436793.1.15310 WP_003436793.1.15435 WP_003436793.1.15908 WP_003436793.1.16012 WP_003436793.1.16135 WP_003436793.1.16185 WP_003436793.1.16376 WP_003436793.1.16520 WP_003436793.1.16728 WP_003436793.1.169 WP_003436793.1.16931 WP_003436793.1.16966 WP_003436793.1.1705 WP_003436793.1.17371 WP_003436793.1.17413 WP_003436793.1.17463 WP_003436793.1.17512 WP_003436793.1.17611 WP_003436793.1.17808 WP_003436793.1.17851 WP_003436793.1.17879 WP_003436793.1.17908 WP_003436793.1.17960 WP_003436793.1.18060 WP_003436793.1.18207 WP_003436793.1.18212 WP_003436793.1.18298 WP_003436793.1.1838 WP_003436793.1.18407 WP_003436793.1.18455 WP_003436793.1.18462 WP_003436793.1.18551 WP_003436793.1.18680 WP_003436793.1.18805 WP_003436793.1.18970 WP_003436793.1.19088 WP_003436793.1.19152 WP_003436793.1.1926 WP_003436793.1.19290 WP_003436793.1.1934 WP_003436793.1.19648 WP_003436793.1.19704 WP_003436793.1.19899 WP_003436793.1.19956 WP_003436793.1.1999 WP_003436793.1.2002 WP_003436793.1.20132 WP_003436793.1.20184 WP_003436793.1.20302 WP_003436793.1.20313 WP_003436793.1.20481 WP_003436793.1.20650 WP_003436793.1.20728 WP_003436793.1.20872 WP_003436793.1.20875 WP_003436793.1.20960 WP_003436793.1.21000 WP_003436793.1.21048 WP_003436793.1.21201 WP_003436793.1.21220 WP_003436793.1.21417 WP_003436793.1.21520 WP_003436793.1.21547 WP_003436793.1.21618 WP_003436793.1.21704 WP_003436793.1.21893 WP_003436793.1.22020 WP_003436793.1.22079 WP_003436793.1.22222 WP_003436793.1.22228 WP_003436793.1.22313 WP_003436793.1.22411 WP_003436793.1.22417 WP_003436793.1.22568 WP_003436793.1.22569 WP_003436793.1.22615 WP_003436793.1.22768 WP_003436793.1.22893 WP_003436793.1.22937 WP_003436793.1.23096 WP_003436793.1.23208 WP_003436793.1.23287 WP_003436793.1.23338 WP_003436793.1.2363 WP_003436793.1.24197 WP_003436793.1.24457 WP_003436793.1.24520 WP_003436793.1.24889 WP_003436793.1.24900 WP_003436793.1.24987 WP_003436793.1.25128 WP_003436793.1.25416 WP_003436793.1.25761 WP_003436793.1.26024 WP_003436793.1.26358 WP_003436793.1.26482 WP_003436793.1.26494 WP_003436793.1.26697 WP_003436793.1.26829 WP_003436793.1.26940 WP_003436793.1.2758 WP_003436793.1.27677 WP_003436793.1.27708 WP_003436793.1.27824 WP_003436793.1.27872 WP_003436793.1.27881 WP_003436793.1.27890 WP_003436793.1.27967 WP_003436793.1.27989 WP_003436793.1.27996 WP_003436793.1.28055 WP_003436793.1.28410 WP_003436793.1.28638 WP_003436793.1.28715 WP_003436793.1.28856 WP_003436793.1.28882 WP_003436793.1.28890 WP_003436793.1.2923 WP_003436793.1.293 WP_003436793.1.29600 WP_003436793.1.29757 WP_003436793.1.2982 WP_003436793.1.29891 WP_003436793.1.3024 WP_003436793.1.303 WP_003436793.1.3031 WP_003436793.1.30420 WP_003436793.1.30431 WP_003436793.1.30463 WP_003436793.1.30519 WP_003436793.1.30521 WP_003436793.1.30743 WP_003436793.1.30841 WP_003436793.1.30953 WP_003436793.1.31160 WP_003436793.1.31183 WP_003436793.1.31203 WP_003436793.1.31292 WP_003436793.1.31309 WP_003436793.1.31351 WP_003436793.1.31385 WP_003436793.1.31453 WP_003436793.1.31475 WP_003436793.1.31477 WP_003436793.1.31519 WP_003436793.1.31719 WP_003436793.1.31742 WP_003436793.1.31960 WP_003436793.1.31969 WP_003436793.1.32008 WP_003436793.1.32066 WP_003436793.1.32119 WP_003436793.1.32166 WP_003436793.1.32197 WP_003436793.1.32218 WP_003436793.1.32230 WP_003436793.1.32294 WP_003436793.1.32699 WP_003436793.1.32769 WP_003436793.1.32776 WP_003436793.1.32842 WP_003436793.1.33056 WP_003436793.1.33098 WP_003436793.1.33164 WP_003436793.1.33298 WP_003436793.1.33332 WP_003436793.1.33349 WP_003436793.1.3340 WP_003436793.1.33514 WP_003436793.1.33810 WP_003436793.1.34388 WP_003436793.1.34489 WP_003436793.1.34545 WP_003436793.1.34641 WP_003436793.1.34800 WP_003436793.1.34985 WP_003436793.1.35 WP_003436793.1.35002 WP_003436793.1.35137 WP_003436793.1.35181 WP_003436793.1.35187 WP_003436793.1.35234 WP_003436793.1.3559 WP_003436793.1.35832 WP_003436793.1.35884 WP_003436793.1.36078 WP_003436793.1.36257 WP_003436793.1.36338 WP_003436793.1.36738 WP_003436793.1.36835 WP_003436793.1.37255 WP_003436793.1.374 WP_003436793.1.37493 WP_003436793.1.37532 WP_003436793.1.37597 WP_003436793.1.37861 WP_003436793.1.3789 WP_003436793.1.37957 WP_003436793.1.37981 WP_003436793.1.38305 WP_003436793.1.38338 WP_003436793.1.38692 WP_003436793.1.38775 WP_003436793.1.38814 WP_003436793.1.38874 WP_003436793.1.38924 WP_003436793.1.38986 WP_003436793.1.3913 WP_003436793.1.39213 WP_003436793.1.39350 WP_003436793.1.39382 WP_003436793.1.39442 WP_003436793.1.39525 WP_003436793.1.39621 WP_003436793.1.39783 WP_003436793.1.39874 WP_003436793.1.39876 WP_003436793.1.39975 WP_003436793.1.39981 WP_003436793.1.40030 WP_003436793.1.40294 WP_003436793.1.40313 WP_003436793.1.40447 WP_003436793.1.40522 WP_003436793.1.40557 WP_003436793.1.407 WP_003436793.1.40775 WP_003436793.1.40891 WP_003436793.1.40959 WP_003436793.1.40966 WP_003436793.1.41131 WP_003436793.1.4121 WP_003436793.1.41334 WP_003436793.1.41342 WP_003436793.1.4137 WP_003436793.1.41506 WP_003436793.1.41534 WP_003436793.1.41641 WP_003436793.1.41687 WP_003436793.1.41818 WP_003436793.1.41995 WP_003436793.1.42035 WP_003436793.1.4204 WP_003436793.1.42066 WP_003436793.1.42532 WP_003436793.1.42533 WP_003436793.1.42610 WP_003436793.1.42664 WP_003436793.1.43112 WP_003436793.1.4315 WP_003436793.1.4321 WP_003436793.1.43388 WP_003436793.1.43519 WP_003436793.1.43579 WP_003436793.1.43824 WP_003436793.1.4383 WP_003436793.1.44030 WP_003436793.1.44105 WP_003436793.1.44149 WP_003436793.1.44198 WP_003436793.1.44241 WP_003436793.1.44470 WP_003436793.1.44471 WP_003436793.1.44729 WP_003436793.1.45017 WP_003436793.1.45059 WP_003436793.1.45142 WP_003436793.1.45165 WP_003436793.1.45209 WP_003436793.1.45257 WP_003436793.1.45352 WP_003436793.1.45554 WP_003436793.1.4573 WP_003436793.1.45938 WP_003436793.1.45986 WP_003436793.1.46066 WP_003436793.1.46274 WP_003436793.1.46280 WP_003436793.1.46305 WP_003436793.1.46522 WP_003436793.1.4698 WP_003436793.1.47016 WP_003436793.1.47121 WP_003436793.1.47227 WP_003436793.1.47228 WP_003436793.1.47479 WP_003436793.1.47615 WP_003436793.1.47708 WP_003436793.1.47729 WP_003436793.1.47940 WP_003436793.1.48246 WP_003436793.1.48279 WP_003436793.1.4835 WP_003436793.1.48746 WP_003436793.1.48772 WP_003436793.1.48935 WP_003436793.1.48980 WP_003436793.1.48983 WP_003436793.1.48991 WP_003436793.1.49020 WP_003436793.1.49054 WP_003436793.1.49065 WP_003436793.1.4908 WP_003436793.1.49092 WP_003436793.1.49230 WP_003436793.1.49310 WP_003436793.1.49339 WP_003436793.1.4948 WP_003436793.1.49633 WP_003436793.1.50159 WP_003436793.1.50341 WP_003436793.1.5073 WP_003436793.1.50865 WP_003436793.1.51007 WP_003436793.1.51235 WP_003436793.1.51675 WP_003436793.1.51996 WP_003436793.1.52073 WP_003436793.1.52266 WP_003436793.1.52278 WP_003436793.1.52311 WP_003436793.1.52330 WP_003436793.1.52383 WP_003436793.1.52402 WP_003436793.1.52466 WP_003436793.1.52525 WP_003436793.1.52789 WP_003436793.1.52958 WP_003436793.1.52997 WP_003436793.1.53044 WP_003436793.1.53055 WP_003436793.1.5337 WP_003436793.1.53504 WP_003436793.1.53704 WP_003436793.1.53710 WP_003436793.1.53729 WP_003436793.1.53987 WP_003436793.1.54058 WP_003436793.1.54153 WP_003436793.1.5423 WP_003436793.1.54262 WP_003436793.1.54586 WP_003436793.1.54692 WP_003436793.1.55055 WP_003436793.1.55101 WP_003436793.1.5521 WP_003436793.1.55302 WP_003436793.1.55371 WP_003436793.1.5558 WP_003436793.1.559 WP_003436793.1.56006 WP_003436793.1.56252 WP_003436793.1.56323 WP_003436793.1.56337 WP_003436793.1.5657 WP_003436793.1.5664 WP_003436793.1.56664 WP_003436793.1.56711 WP_003436793.1.56754 WP_003436793.1.56927 WP_003436793.1.56998 WP_003436793.1.57337 WP_003436793.1.5750 WP_003436793.1.57711 WP_003436793.1.57827 WP_003436793.1.58015 WP_003436793.1.58216 WP_003436793.1.58304 WP_003436793.1.58315 WP_003436793.1.58323 WP_003436793.1.58463 WP_003436793.1.58531 WP_003436793.1.58665 WP_003436793.1.58677 WP_003436793.1.58711 WP_003436793.1.58818 WP_003436793.1.58956 WP_003436793.1.5905 WP_003436793.1.59588 WP_003436793.1.59618 WP_003436793.1.59628 WP_003436793.1.59707 WP_003436793.1.59752 WP_003436793.1.59990 WP_003436793.1.6031 WP_003436793.1.60482 WP_003436793.1.60563 WP_003436793.1.6070 WP_003436793.1.60957 WP_003436793.1.60998 WP_003436793.1.61042 WP_003436793.1.61140 WP_003436793.1.61293 WP_003436793.1.61492 WP_003436793.1.61679 WP_003436793.1.61716 WP_003436793.1.61866 WP_003436793.1.61972 WP_003436793.1.62049 WP_003436793.1.62095 WP_003436793.1.62128 WP_003436793.1.62340 WP_003436793.1.62577 WP_003436793.1.62624 WP_003436793.1.62637 WP_003436793.1.62941 WP_003436793.1.63020 WP_003436793.1.63059 WP_003436793.1.63239 WP_003436793.1.63248 WP_003436793.1.63343 WP_003436793.1.63378 WP_003436793.1.63516 WP_003436793.1.63570 WP_003436793.1.63581 WP_003436793.1.63598 WP_003436793.1.63599 WP_003436793.1.63696 WP_003436793.1.63804 WP_003436793.1.63853 WP_003436793.1.64020 WP_003436793.1.64092 WP_003436793.1.64197 WP_003436793.1.64369 WP_003436793.1.64447 WP_003436793.1.64546 WP_003436793.1.64573 WP_003436793.1.64859 WP_003436793.1.65064 WP_003436793.1.65067 WP_003436793.1.65369 WP_003436793.1.65889 WP_003436793.1.66084 WP_003436793.1.66119 WP_003436793.1.66237 WP_003436793.1.66439 WP_003436793.1.66474 WP_003436793.1.66565 WP_003436793.1.66643 WP_003436793.1.66701 WP_003436793.1.6671 WP_003436793.1.6675 WP_003436793.1.66805 WP_003436793.1.66847 WP_003436793.1.6685 WP_003436793.1.66887 WP_003436793.1.66888 WP_003436793.1.66900 WP_003436793.1.670 WP_003436793.1.67303 WP_003436793.1.67308 WP_003436793.1.6736 WP_003436793.1.67368 WP_003436793.1.67528 WP_003436793.1.67689 WP_003436793.1.67695 WP_003436793.1.67711 WP_003436793.1.6792 WP_003436793.1.67951 WP_003436793.1.68150 WP_003436793.1.68322 WP_003436793.1.68955 WP_003436793.1.6898 WP_003436793.1.68980 WP_003436793.1.69114 WP_003436793.1.692 WP_003436793.1.69220 WP_003436793.1.69333 WP_003436793.1.69495 WP_003436793.1.69708 WP_003436793.1.6994 WP_003436793.1.700 WP_003436793.1.70152 WP_003436793.1.70179 WP_003436793.1.70231 WP_003436793.1.70320 WP_003436793.1.70695 WP_003436793.1.70710 WP_003436793.1.70820 WP_003436793.1.70886 WP_003436793.1.71079 WP_003436793.1.71119 WP_003436793.1.713 WP_003436793.1.71384 WP_003436793.1.71477 WP_003436793.1.7156 WP_003436793.1.71745 WP_003436793.1.7199 WP_003436793.1.72113 WP_003436793.1.72245 WP_003436793.1.72468 WP_003436793.1.72483 WP_003436793.1.72560 WP_003436793.1.72682 WP_003436793.1.72891 WP_003436793.1.72909 WP_003436793.1.72914 WP_003436793.1.72994 WP_003436793.1.73026 WP_003436793.1.73116 WP_003436793.1.7322 WP_003436793.1.73852 WP_003436793.1.73931 WP_003436793.1.74116 WP_003436793.1.74126 WP_003436793.1.74672 WP_003436793.1.74678 WP_003436793.1.74680 WP_003436793.1.74835 WP_003436793.1.74897 WP_003436793.1.75026 WP_003436793.1.751 WP_003436793.1.75210 WP_003436793.1.75226 WP_003436793.1.75287 WP_003436793.1.75454 WP_003436793.1.75638 WP_003436793.1.75659 WP_003436793.1.76207 WP_003436793.1.7650 WP_003436793.1.76550 WP_003436793.1.76552 WP_003436793.1.76603 WP_003436793.1.76621 WP_003436793.1.76664 WP_003436793.1.76687 WP_003436793.1.76793 WP_003436793.1.76813 WP_003436793.1.76882 WP_003436793.1.76924 WP_003436793.1.7696 WP_003436793.1.77092 WP_003436793.1.77102 WP_003436793.1.77473 WP_003436793.1.77509 WP_003436793.1.77544 WP_003436793.1.7755 WP_003436793.1.77639 WP_003436793.1.77782 WP_003436793.1.77842 WP_003436793.1.77942 WP_003436793.1.78123 WP_003436793.1.78579 WP_003436793.1.78949 WP_003436793.1.7916 WP_003436793.1.79199 WP_003436793.1.79221 WP_003436793.1.79309 WP_003436793.1.79344 WP_003436793.1.79437 WP_003436793.1.79611 WP_003436793.1.79680 WP_003436793.1.79703 WP_003436793.1.79836 WP_003436793.1.79956 WP_003436793.1.80052 WP_003436793.1.80144 WP_003436793.1.80342 WP_003436793.1.80379 WP_003436793.1.80455 WP_003436793.1.80504 WP_003436793.1.80575 WP_003436793.1.80963 WP_003436793.1.81035 WP_003436793.1.81044 WP_003436793.1.81208 WP_003436793.1.81299 WP_003436793.1.81351 WP_003436793.1.81402 WP_003436793.1.81605 WP_003436793.1.82084 WP_003436793.1.82169 WP_003436793.1.82335 WP_003436793.1.82635 WP_003436793.1.82701 WP_003436793.1.82920 WP_003436793.1.8314 WP_003436793.1.83148 WP_003436793.1.83175 WP_003436793.1.83255 WP_003436793.1.83287 WP_003436793.1.83288 WP_003436793.1.83318 WP_003436793.1.83348 WP_003436793.1.834 WP_003436793.1.83477 WP_003436793.1.83515 WP_003436793.1.83822 WP_003436793.1.83918 WP_003436793.1.84253 WP_003436793.1.84528 WP_003436793.1.84646 WP_003436793.1.84843 WP_003436793.1.84880 WP_003436793.1.84923 WP_003436793.1.85020 WP_003436793.1.85127 WP_003436793.1.85214 WP_003436793.1.85219 WP_003436793.1.8527 WP_003436793.1.85420 WP_003436793.1.85454 WP_003436793.1.85776 WP_003436793.1.85863 WP_003436793.1.8587 WP_003436793.1.85874 WP_003436793.1.85932 WP_003436793.1.86008 WP_003436793.1.86011 WP_003436793.1.86049 WP_003436793.1.86088 WP_003436793.1.86094 WP_003436793.1.86116 WP_003436793.1.86117 WP_003436793.1.86328 WP_003436793.1.86395 WP_003436793.1.86534 WP_003436793.1.86743 WP_003436793.1.86767 WP_003436793.1.86837 WP_003436793.1.86914 WP_003436793.1.87058 WP_003436793.1.87195 WP_003436793.1.87326 WP_003436793.1.87454 WP_003436793.1.87714 WP_003436793.1.87723 WP_003436793.1.87730 WP_003436793.1.87918 WP_003436793.1.87932 WP_003436793.1.882 WP_003436793.1.88268 WP_003436793.1.88332 WP_003436793.1.88364 WP_003436793.1.88372 WP_003436793.1.88377 WP_003436793.1.88608 WP_003436793.1.88640 WP_003436793.1.88996 WP_003436793.1.89052 WP_003436793.1.89065 WP_003436793.1.89196 WP_003436793.1.89337 WP_003436793.1.89364 WP_003436793.1.89457 WP_003436793.1.89629 WP_003436793.1.89697 WP_003436793.1.89994 WP_003436793.1.90076 WP_003436793.1.90101 WP_003436793.1.90164 WP_003436793.1.90329 WP_003436793.1.9041 WP_003436793.1.90491 WP_003436793.1.90555 WP_003436793.1.90643 WP_003436793.1.9083 WP_003436793.1.90921 WP_003436793.1.90938 WP_003436793.1.90981 WP_003436793.1.91065 WP_003436793.1.91254 WP_003436793.1.91314 WP_003436793.1.91406 WP_003436793.1.91570 WP_003436793.1.91648 WP_003436793.1.92075 WP_003436793.1.92284 WP_003436793.1.92371 WP_003436793.1.92576 WP_003436793.1.92658 WP_003436793.1.92697 WP_003436793.1.92941 WP_003436793.1.93044 WP_003436793.1.93171 WP_003436793.1.93313 WP_003436793.1.93360 WP_003436793.1.93480 WP_003436793.1.93615 WP_003436793.1.93687 WP_003436793.1.93717 WP_003436793.1.93766 WP_003436793.1.93782 WP_003436793.1.93798 WP_003436793.1.93802 WP_003436793.1.93830 WP_003436793.1.9393 WP_003436793.1.94067 WP_003436793.1.94073 WP_003436793.1.94166 WP_003436793.1.94427 WP_003436793.1.94768 WP_003436793.1.94968 WP_003436793.1.95095 WP_003436793.1.95173 WP_003436793.1.9522 WP_003436793.1.95350 WP_003436793.1.95517 WP_003436793.1.95847 WP_003436793.1.95893 WP_003436793.1.96113 WP_003436793.1.9635 WP_003436793.1.96503 WP_003436793.1.96505 WP_003436793.1.9666 WP_003436793.1.96690 WP_003436793.1.96765 WP_003436793.1.97219 WP_003436793.1.97458 WP_003436793.1.97672 WP_003436793.1.97682 WP_003436793.1.97806 WP_003436793.1.98037 WP_003436793.1.98514 WP_003436793.1.98622 WP_003436793.1.98698 WP_003436793.1.98715 WP_003436793.1.98748 WP_003436793.1.98856 WP_003436793.1.98997 WP_003436793.1.99064 WP_003436793.1.99134 WP_003436793.1.99333 WP_003436793.1.99542 WP_003436793.1.99545 WP_003436793.1.99731 WP_003436793.1.9986 YP_001089357.1.32744 gi|260688080|ref|YP_003219214.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]