SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260684531|ref|YP_003215816.1| from Clostridium difficile CD196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260684531|ref|YP_003215816.1|
Domain Number 1 Region: 6-106
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.56e-21
Family HxlR-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|260684531|ref|YP_003215816.1|
Sequence length 111
Comment transcriptional regulator [Clostridium difficile CD196]
Sequence
MYNIDDMIYNCPVEALSNILGKKWVAIIIWKIQEDKKRFGELQRAIPDCSKKMLVQQLDF
LIEQGIIVNQKKLVNNVVESTYFLSESGLRLLPVMEKMIMWSNKNLNCDKY
Download sequence
Identical sequences A0A031WCD2 A0A0H3N5K6 A0A0J0UE69 A0A125V9K5 A0A1F2D8N8 C9YQI0 G6BFY2 Q184K2
272563.CD3011 645462.CD196_2800 645463.CDR20291_2847 gi|260688189|ref|YP_003219323.1| gi|260684531|ref|YP_003215816.1| gi|126700631|ref|YP_001089528.1| WP_003431984.1.100055 WP_003431984.1.100097 WP_003431984.1.100107 WP_003431984.1.100118 WP_003431984.1.100139 WP_003431984.1.100513 WP_003431984.1.100570 WP_003431984.1.100660 WP_003431984.1.100831 WP_003431984.1.100977 WP_003431984.1.101035 WP_003431984.1.101125 WP_003431984.1.101279 WP_003431984.1.10130 WP_003431984.1.101316 WP_003431984.1.101532 WP_003431984.1.101861 WP_003431984.1.102031 WP_003431984.1.102074 WP_003431984.1.102095 WP_003431984.1.10483 WP_003431984.1.10488 WP_003431984.1.10582 WP_003431984.1.10691 WP_003431984.1.10793 WP_003431984.1.10795 WP_003431984.1.11025 WP_003431984.1.11224 WP_003431984.1.11278 WP_003431984.1.11320 WP_003431984.1.11398 WP_003431984.1.1167 WP_003431984.1.1179 WP_003431984.1.11937 WP_003431984.1.11959 WP_003431984.1.12066 WP_003431984.1.12169 WP_003431984.1.12385 WP_003431984.1.1254 WP_003431984.1.12629 WP_003431984.1.12632 WP_003431984.1.12659 WP_003431984.1.1273 WP_003431984.1.12734 WP_003431984.1.12807 WP_003431984.1.12809 WP_003431984.1.13040 WP_003431984.1.13251 WP_003431984.1.13273 WP_003431984.1.13398 WP_003431984.1.13418 WP_003431984.1.13730 WP_003431984.1.13841 WP_003431984.1.13859 WP_003431984.1.14045 WP_003431984.1.141 WP_003431984.1.14170 WP_003431984.1.14177 WP_003431984.1.14205 WP_003431984.1.1422 WP_003431984.1.14259 WP_003431984.1.14330 WP_003431984.1.14352 WP_003431984.1.1445 WP_003431984.1.14457 WP_003431984.1.14483 WP_003431984.1.14579 WP_003431984.1.14674 WP_003431984.1.14686 WP_003431984.1.14698 WP_003431984.1.14848 WP_003431984.1.1494 WP_003431984.1.15083 WP_003431984.1.15097 WP_003431984.1.15192 WP_003431984.1.15205 WP_003431984.1.15310 WP_003431984.1.15435 WP_003431984.1.15908 WP_003431984.1.16012 WP_003431984.1.16135 WP_003431984.1.16185 WP_003431984.1.16376 WP_003431984.1.16520 WP_003431984.1.16728 WP_003431984.1.169 WP_003431984.1.16931 WP_003431984.1.16966 WP_003431984.1.1705 WP_003431984.1.17371 WP_003431984.1.17413 WP_003431984.1.17463 WP_003431984.1.17512 WP_003431984.1.17611 WP_003431984.1.17638 WP_003431984.1.17808 WP_003431984.1.17851 WP_003431984.1.17879 WP_003431984.1.17908 WP_003431984.1.17960 WP_003431984.1.18060 WP_003431984.1.18207 WP_003431984.1.18212 WP_003431984.1.18298 WP_003431984.1.1838 WP_003431984.1.18407 WP_003431984.1.18455 WP_003431984.1.18462 WP_003431984.1.18551 WP_003431984.1.18680 WP_003431984.1.18805 WP_003431984.1.18970 WP_003431984.1.19088 WP_003431984.1.19152 WP_003431984.1.1926 WP_003431984.1.19290 WP_003431984.1.1934 WP_003431984.1.19648 WP_003431984.1.19704 WP_003431984.1.19899 WP_003431984.1.19956 WP_003431984.1.1999 WP_003431984.1.2002 WP_003431984.1.20184 WP_003431984.1.20302 WP_003431984.1.20313 WP_003431984.1.20481 WP_003431984.1.20650 WP_003431984.1.20728 WP_003431984.1.20872 WP_003431984.1.20875 WP_003431984.1.20960 WP_003431984.1.21000 WP_003431984.1.21048 WP_003431984.1.21201 WP_003431984.1.21220 WP_003431984.1.21417 WP_003431984.1.21520 WP_003431984.1.21547 WP_003431984.1.21618 WP_003431984.1.21704 WP_003431984.1.21893 WP_003431984.1.22020 WP_003431984.1.22079 WP_003431984.1.22222 WP_003431984.1.22228 WP_003431984.1.22313 WP_003431984.1.22411 WP_003431984.1.22417 WP_003431984.1.22568 WP_003431984.1.22569 WP_003431984.1.22615 WP_003431984.1.22768 WP_003431984.1.22893 WP_003431984.1.22937 WP_003431984.1.23096 WP_003431984.1.23208 WP_003431984.1.23287 WP_003431984.1.23338 WP_003431984.1.2363 WP_003431984.1.24197 WP_003431984.1.24457 WP_003431984.1.24520 WP_003431984.1.24889 WP_003431984.1.24900 WP_003431984.1.24987 WP_003431984.1.25128 WP_003431984.1.25416 WP_003431984.1.25761 WP_003431984.1.26024 WP_003431984.1.26358 WP_003431984.1.26482 WP_003431984.1.26494 WP_003431984.1.26697 WP_003431984.1.26829 WP_003431984.1.26940 WP_003431984.1.2758 WP_003431984.1.27677 WP_003431984.1.27708 WP_003431984.1.27824 WP_003431984.1.27872 WP_003431984.1.27881 WP_003431984.1.27890 WP_003431984.1.27967 WP_003431984.1.27989 WP_003431984.1.27996 WP_003431984.1.28055 WP_003431984.1.28410 WP_003431984.1.28638 WP_003431984.1.28715 WP_003431984.1.28856 WP_003431984.1.28882 WP_003431984.1.28890 WP_003431984.1.28930 WP_003431984.1.2923 WP_003431984.1.293 WP_003431984.1.29600 WP_003431984.1.29757 WP_003431984.1.2982 WP_003431984.1.29891 WP_003431984.1.3024 WP_003431984.1.303 WP_003431984.1.3031 WP_003431984.1.30420 WP_003431984.1.30431 WP_003431984.1.30463 WP_003431984.1.30519 WP_003431984.1.30521 WP_003431984.1.30743 WP_003431984.1.30841 WP_003431984.1.30953 WP_003431984.1.31160 WP_003431984.1.31183 WP_003431984.1.31203 WP_003431984.1.31292 WP_003431984.1.31309 WP_003431984.1.31351 WP_003431984.1.31385 WP_003431984.1.31453 WP_003431984.1.31475 WP_003431984.1.31477 WP_003431984.1.31519 WP_003431984.1.31637 WP_003431984.1.31742 WP_003431984.1.31960 WP_003431984.1.31969 WP_003431984.1.32008 WP_003431984.1.32066 WP_003431984.1.32119 WP_003431984.1.32166 WP_003431984.1.32197 WP_003431984.1.32218 WP_003431984.1.32230 WP_003431984.1.32294 WP_003431984.1.32699 WP_003431984.1.32769 WP_003431984.1.32776 WP_003431984.1.32842 WP_003431984.1.33056 WP_003431984.1.33098 WP_003431984.1.33164 WP_003431984.1.33298 WP_003431984.1.33349 WP_003431984.1.3340 WP_003431984.1.33514 WP_003431984.1.33810 WP_003431984.1.34388 WP_003431984.1.34489 WP_003431984.1.34545 WP_003431984.1.34641 WP_003431984.1.34800 WP_003431984.1.34985 WP_003431984.1.35 WP_003431984.1.35002 WP_003431984.1.35137 WP_003431984.1.35181 WP_003431984.1.35187 WP_003431984.1.35234 WP_003431984.1.3559 WP_003431984.1.35832 WP_003431984.1.35884 WP_003431984.1.36078 WP_003431984.1.36257 WP_003431984.1.36338 WP_003431984.1.36738 WP_003431984.1.36835 WP_003431984.1.37255 WP_003431984.1.374 WP_003431984.1.37493 WP_003431984.1.37532 WP_003431984.1.37597 WP_003431984.1.37861 WP_003431984.1.37957 WP_003431984.1.37981 WP_003431984.1.38305 WP_003431984.1.38338 WP_003431984.1.38692 WP_003431984.1.38775 WP_003431984.1.38814 WP_003431984.1.38874 WP_003431984.1.38924 WP_003431984.1.38986 WP_003431984.1.39008 WP_003431984.1.3913 WP_003431984.1.39213 WP_003431984.1.39350 WP_003431984.1.39382 WP_003431984.1.39442 WP_003431984.1.39525 WP_003431984.1.39621 WP_003431984.1.39783 WP_003431984.1.39874 WP_003431984.1.39876 WP_003431984.1.39975 WP_003431984.1.39981 WP_003431984.1.40030 WP_003431984.1.40294 WP_003431984.1.40313 WP_003431984.1.40447 WP_003431984.1.40522 WP_003431984.1.40557 WP_003431984.1.407 WP_003431984.1.40775 WP_003431984.1.40891 WP_003431984.1.40959 WP_003431984.1.40966 WP_003431984.1.41131 WP_003431984.1.4121 WP_003431984.1.41334 WP_003431984.1.41342 WP_003431984.1.4137 WP_003431984.1.41506 WP_003431984.1.41534 WP_003431984.1.41641 WP_003431984.1.41687 WP_003431984.1.41818 WP_003431984.1.41995 WP_003431984.1.42035 WP_003431984.1.4204 WP_003431984.1.42066 WP_003431984.1.42532 WP_003431984.1.42533 WP_003431984.1.42610 WP_003431984.1.42664 WP_003431984.1.43112 WP_003431984.1.4321 WP_003431984.1.43388 WP_003431984.1.43490 WP_003431984.1.43519 WP_003431984.1.43579 WP_003431984.1.43663 WP_003431984.1.43824 WP_003431984.1.4383 WP_003431984.1.44030 WP_003431984.1.44105 WP_003431984.1.44149 WP_003431984.1.44198 WP_003431984.1.44241 WP_003431984.1.44470 WP_003431984.1.44471 WP_003431984.1.44729 WP_003431984.1.45017 WP_003431984.1.45059 WP_003431984.1.45142 WP_003431984.1.45165 WP_003431984.1.45209 WP_003431984.1.45257 WP_003431984.1.45352 WP_003431984.1.45554 WP_003431984.1.4573 WP_003431984.1.45938 WP_003431984.1.45986 WP_003431984.1.46066 WP_003431984.1.46274 WP_003431984.1.46280 WP_003431984.1.46305 WP_003431984.1.46522 WP_003431984.1.4698 WP_003431984.1.47016 WP_003431984.1.47121 WP_003431984.1.47227 WP_003431984.1.47228 WP_003431984.1.47479 WP_003431984.1.47615 WP_003431984.1.47708 WP_003431984.1.47729 WP_003431984.1.47940 WP_003431984.1.48246 WP_003431984.1.48279 WP_003431984.1.4835 WP_003431984.1.48746 WP_003431984.1.48772 WP_003431984.1.48935 WP_003431984.1.48983 WP_003431984.1.48991 WP_003431984.1.49020 WP_003431984.1.49054 WP_003431984.1.49065 WP_003431984.1.4908 WP_003431984.1.49230 WP_003431984.1.49310 WP_003431984.1.49339 WP_003431984.1.4948 WP_003431984.1.49633 WP_003431984.1.50159 WP_003431984.1.50341 WP_003431984.1.5073 WP_003431984.1.50865 WP_003431984.1.51007 WP_003431984.1.51235 WP_003431984.1.51675 WP_003431984.1.51996 WP_003431984.1.52073 WP_003431984.1.52266 WP_003431984.1.52278 WP_003431984.1.52311 WP_003431984.1.52330 WP_003431984.1.52383 WP_003431984.1.52466 WP_003431984.1.52525 WP_003431984.1.52789 WP_003431984.1.52958 WP_003431984.1.52997 WP_003431984.1.53008 WP_003431984.1.53044 WP_003431984.1.53055 WP_003431984.1.5337 WP_003431984.1.53504 WP_003431984.1.53704 WP_003431984.1.53710 WP_003431984.1.53729 WP_003431984.1.53987 WP_003431984.1.54058 WP_003431984.1.54153 WP_003431984.1.5423 WP_003431984.1.54262 WP_003431984.1.54350 WP_003431984.1.54586 WP_003431984.1.54692 WP_003431984.1.55055 WP_003431984.1.55101 WP_003431984.1.5521 WP_003431984.1.55302 WP_003431984.1.55371 WP_003431984.1.55391 WP_003431984.1.559 WP_003431984.1.56006 WP_003431984.1.56217 WP_003431984.1.56252 WP_003431984.1.56323 WP_003431984.1.56337 WP_003431984.1.56556 WP_003431984.1.5657 WP_003431984.1.5661 WP_003431984.1.5664 WP_003431984.1.56664 WP_003431984.1.56711 WP_003431984.1.56754 WP_003431984.1.56927 WP_003431984.1.56998 WP_003431984.1.5750 WP_003431984.1.57711 WP_003431984.1.57827 WP_003431984.1.58015 WP_003431984.1.58216 WP_003431984.1.58304 WP_003431984.1.58315 WP_003431984.1.58323 WP_003431984.1.58463 WP_003431984.1.58531 WP_003431984.1.58665 WP_003431984.1.58677 WP_003431984.1.58818 WP_003431984.1.58956 WP_003431984.1.59032 WP_003431984.1.5905 WP_003431984.1.59588 WP_003431984.1.59618 WP_003431984.1.59628 WP_003431984.1.59707 WP_003431984.1.59752 WP_003431984.1.59990 WP_003431984.1.6031 WP_003431984.1.60482 WP_003431984.1.60563 WP_003431984.1.6070 WP_003431984.1.60957 WP_003431984.1.60998 WP_003431984.1.61042 WP_003431984.1.61140 WP_003431984.1.61293 WP_003431984.1.61492 WP_003431984.1.61679 WP_003431984.1.61716 WP_003431984.1.61866 WP_003431984.1.61972 WP_003431984.1.62049 WP_003431984.1.62095 WP_003431984.1.62128 WP_003431984.1.62577 WP_003431984.1.62624 WP_003431984.1.62637 WP_003431984.1.62941 WP_003431984.1.62986 WP_003431984.1.63020 WP_003431984.1.63059 WP_003431984.1.63237 WP_003431984.1.63239 WP_003431984.1.63248 WP_003431984.1.63343 WP_003431984.1.63378 WP_003431984.1.63516 WP_003431984.1.63570 WP_003431984.1.63581 WP_003431984.1.63598 WP_003431984.1.63599 WP_003431984.1.63696 WP_003431984.1.63853 WP_003431984.1.64020 WP_003431984.1.64092 WP_003431984.1.64197 WP_003431984.1.64369 WP_003431984.1.64447 WP_003431984.1.64546 WP_003431984.1.64573 WP_003431984.1.64859 WP_003431984.1.65064 WP_003431984.1.65067 WP_003431984.1.65369 WP_003431984.1.65889 WP_003431984.1.66084 WP_003431984.1.66237 WP_003431984.1.66439 WP_003431984.1.66474 WP_003431984.1.66565 WP_003431984.1.66587 WP_003431984.1.66608 WP_003431984.1.66643 WP_003431984.1.66701 WP_003431984.1.6671 WP_003431984.1.6675 WP_003431984.1.66805 WP_003431984.1.66847 WP_003431984.1.6685 WP_003431984.1.66887 WP_003431984.1.66888 WP_003431984.1.66900 WP_003431984.1.670 WP_003431984.1.67303 WP_003431984.1.67308 WP_003431984.1.6736 WP_003431984.1.67368 WP_003431984.1.67528 WP_003431984.1.67689 WP_003431984.1.67695 WP_003431984.1.67711 WP_003431984.1.6792 WP_003431984.1.67951 WP_003431984.1.68150 WP_003431984.1.68322 WP_003431984.1.68955 WP_003431984.1.6898 WP_003431984.1.68980 WP_003431984.1.69114 WP_003431984.1.692 WP_003431984.1.69220 WP_003431984.1.69333 WP_003431984.1.69495 WP_003431984.1.69708 WP_003431984.1.6994 WP_003431984.1.700 WP_003431984.1.70152 WP_003431984.1.70179 WP_003431984.1.70231 WP_003431984.1.70320 WP_003431984.1.70695 WP_003431984.1.70710 WP_003431984.1.70820 WP_003431984.1.70886 WP_003431984.1.71079 WP_003431984.1.71119 WP_003431984.1.713 WP_003431984.1.71384 WP_003431984.1.71477 WP_003431984.1.7156 WP_003431984.1.7199 WP_003431984.1.72113 WP_003431984.1.72245 WP_003431984.1.72468 WP_003431984.1.72483 WP_003431984.1.72560 WP_003431984.1.72682 WP_003431984.1.72891 WP_003431984.1.72909 WP_003431984.1.72914 WP_003431984.1.72994 WP_003431984.1.73026 WP_003431984.1.73116 WP_003431984.1.7322 WP_003431984.1.73852 WP_003431984.1.73931 WP_003431984.1.74116 WP_003431984.1.74126 WP_003431984.1.74672 WP_003431984.1.74678 WP_003431984.1.74680 WP_003431984.1.74835 WP_003431984.1.74897 WP_003431984.1.75026 WP_003431984.1.751 WP_003431984.1.75210 WP_003431984.1.75226 WP_003431984.1.75287 WP_003431984.1.75454 WP_003431984.1.75638 WP_003431984.1.75659 WP_003431984.1.76207 WP_003431984.1.7650 WP_003431984.1.76550 WP_003431984.1.76552 WP_003431984.1.76603 WP_003431984.1.76621 WP_003431984.1.76664 WP_003431984.1.76793 WP_003431984.1.76813 WP_003431984.1.76882 WP_003431984.1.7696 WP_003431984.1.77092 WP_003431984.1.77102 WP_003431984.1.77473 WP_003431984.1.77509 WP_003431984.1.77544 WP_003431984.1.7755 WP_003431984.1.77639 WP_003431984.1.77842 WP_003431984.1.77942 WP_003431984.1.78123 WP_003431984.1.78579 WP_003431984.1.78949 WP_003431984.1.7916 WP_003431984.1.79199 WP_003431984.1.79221 WP_003431984.1.79309 WP_003431984.1.79344 WP_003431984.1.79437 WP_003431984.1.79611 WP_003431984.1.79680 WP_003431984.1.79703 WP_003431984.1.79836 WP_003431984.1.80052 WP_003431984.1.80144 WP_003431984.1.80342 WP_003431984.1.80379 WP_003431984.1.80455 WP_003431984.1.80504 WP_003431984.1.80575 WP_003431984.1.80963 WP_003431984.1.81035 WP_003431984.1.81044 WP_003431984.1.81208 WP_003431984.1.81299 WP_003431984.1.81351 WP_003431984.1.81402 WP_003431984.1.81605 WP_003431984.1.81777 WP_003431984.1.82084 WP_003431984.1.82169 WP_003431984.1.82335 WP_003431984.1.82635 WP_003431984.1.82701 WP_003431984.1.82920 WP_003431984.1.8314 WP_003431984.1.83148 WP_003431984.1.83175 WP_003431984.1.83255 WP_003431984.1.83287 WP_003431984.1.83288 WP_003431984.1.83318 WP_003431984.1.83348 WP_003431984.1.834 WP_003431984.1.83477 WP_003431984.1.83515 WP_003431984.1.83822 WP_003431984.1.84253 WP_003431984.1.84528 WP_003431984.1.84646 WP_003431984.1.84843 WP_003431984.1.84880 WP_003431984.1.84923 WP_003431984.1.85020 WP_003431984.1.85127 WP_003431984.1.85214 WP_003431984.1.85219 WP_003431984.1.8527 WP_003431984.1.85420 WP_003431984.1.85442 WP_003431984.1.85454 WP_003431984.1.85776 WP_003431984.1.85863 WP_003431984.1.8587 WP_003431984.1.85874 WP_003431984.1.85932 WP_003431984.1.86008 WP_003431984.1.86011 WP_003431984.1.86049 WP_003431984.1.86088 WP_003431984.1.86094 WP_003431984.1.86116 WP_003431984.1.86117 WP_003431984.1.86328 WP_003431984.1.86395 WP_003431984.1.86534 WP_003431984.1.86743 WP_003431984.1.86837 WP_003431984.1.86914 WP_003431984.1.87058 WP_003431984.1.87195 WP_003431984.1.87326 WP_003431984.1.87454 WP_003431984.1.87714 WP_003431984.1.87723 WP_003431984.1.87730 WP_003431984.1.87918 WP_003431984.1.87932 WP_003431984.1.88091 WP_003431984.1.882 WP_003431984.1.88268 WP_003431984.1.88332 WP_003431984.1.88364 WP_003431984.1.88372 WP_003431984.1.88377 WP_003431984.1.88608 WP_003431984.1.88640 WP_003431984.1.88996 WP_003431984.1.89052 WP_003431984.1.89065 WP_003431984.1.89196 WP_003431984.1.89337 WP_003431984.1.89364 WP_003431984.1.89457 WP_003431984.1.89629 WP_003431984.1.89697 WP_003431984.1.89994 WP_003431984.1.90076 WP_003431984.1.90101 WP_003431984.1.90164 WP_003431984.1.90329 WP_003431984.1.9041 WP_003431984.1.90491 WP_003431984.1.90555 WP_003431984.1.90643 WP_003431984.1.9083 WP_003431984.1.90921 WP_003431984.1.90938 WP_003431984.1.90981 WP_003431984.1.91065 WP_003431984.1.91254 WP_003431984.1.91314 WP_003431984.1.91406 WP_003431984.1.91570 WP_003431984.1.91648 WP_003431984.1.92075 WP_003431984.1.92284 WP_003431984.1.92371 WP_003431984.1.92576 WP_003431984.1.92658 WP_003431984.1.92697 WP_003431984.1.92941 WP_003431984.1.93044 WP_003431984.1.93171 WP_003431984.1.93313 WP_003431984.1.93360 WP_003431984.1.93480 WP_003431984.1.93615 WP_003431984.1.93687 WP_003431984.1.93717 WP_003431984.1.93766 WP_003431984.1.93782 WP_003431984.1.93798 WP_003431984.1.93802 WP_003431984.1.93830 WP_003431984.1.9393 WP_003431984.1.94067 WP_003431984.1.94073 WP_003431984.1.94166 WP_003431984.1.94427 WP_003431984.1.94768 WP_003431984.1.94968 WP_003431984.1.95095 WP_003431984.1.95173 WP_003431984.1.9522 WP_003431984.1.95350 WP_003431984.1.95517 WP_003431984.1.9580 WP_003431984.1.95847 WP_003431984.1.95893 WP_003431984.1.96113 WP_003431984.1.9635 WP_003431984.1.96503 WP_003431984.1.96505 WP_003431984.1.9666 WP_003431984.1.96690 WP_003431984.1.96765 WP_003431984.1.97219 WP_003431984.1.97458 WP_003431984.1.97672 WP_003431984.1.97682 WP_003431984.1.97806 WP_003431984.1.98037 WP_003431984.1.98514 WP_003431984.1.98622 WP_003431984.1.98698 WP_003431984.1.98715 WP_003431984.1.98748 WP_003431984.1.98856 WP_003431984.1.98997 WP_003431984.1.99064 WP_003431984.1.99134 WP_003431984.1.99333 WP_003431984.1.99542 WP_003431984.1.99545 WP_003431984.1.99731 WP_003431984.1.9986 YP_001089528.1.32744 gi|384362182|ref|YP_006200034.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]