SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260684649|ref|YP_003215934.1| from Clostridium difficile CD196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260684649|ref|YP_003215934.1|
Domain Number 1 Region: 17-92
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.75e-19
Family ArsR-like transcriptional regulators 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|260684649|ref|YP_003215934.1|
Sequence length 121
Comment ArsR family transcriptional regulator [Clostridium difficile CD196]
Sequence
MEKECQQRMQEITSKFKECRKAISAMGDETRQLILIALLESDFNGIRVGEITKKTHLSRP
AVSHHLKILKEAEIVNLRREGTKNYYYLDSKKSQWKSLTELINLIFVGIQHISENDIRKG
D
Download sequence
Identical sequences A0A0H3N5V8 A0A0J0UEG2 A0A125VB26 A0A160Y7D3 A0A1F2DCQ4 C9YQU8 Q184W1
gi|260688307|ref|YP_003219441.1| gi|126700740|ref|YP_001089637.1| gi|260684649|ref|YP_003215934.1| gi|384362308|ref|YP_006200160.1| WP_003440040.1.100055 WP_003440040.1.100097 WP_003440040.1.100107 WP_003440040.1.100118 WP_003440040.1.100139 WP_003440040.1.100513 WP_003440040.1.100570 WP_003440040.1.100660 WP_003440040.1.100831 WP_003440040.1.100977 WP_003440040.1.101035 WP_003440040.1.101125 WP_003440040.1.101279 WP_003440040.1.10130 WP_003440040.1.101316 WP_003440040.1.101532 WP_003440040.1.101861 WP_003440040.1.102031 WP_003440040.1.102074 WP_003440040.1.102095 WP_003440040.1.10483 WP_003440040.1.10488 WP_003440040.1.10691 WP_003440040.1.10793 WP_003440040.1.11025 WP_003440040.1.11224 WP_003440040.1.11278 WP_003440040.1.11320 WP_003440040.1.11398 WP_003440040.1.1167 WP_003440040.1.1179 WP_003440040.1.11937 WP_003440040.1.12066 WP_003440040.1.12169 WP_003440040.1.12385 WP_003440040.1.1254 WP_003440040.1.12629 WP_003440040.1.12632 WP_003440040.1.12659 WP_003440040.1.1273 WP_003440040.1.12734 WP_003440040.1.12809 WP_003440040.1.13040 WP_003440040.1.13251 WP_003440040.1.13273 WP_003440040.1.13398 WP_003440040.1.13418 WP_003440040.1.13730 WP_003440040.1.13841 WP_003440040.1.141 WP_003440040.1.14170 WP_003440040.1.14177 WP_003440040.1.14205 WP_003440040.1.1422 WP_003440040.1.14259 WP_003440040.1.14330 WP_003440040.1.14352 WP_003440040.1.1445 WP_003440040.1.14457 WP_003440040.1.14483 WP_003440040.1.14579 WP_003440040.1.14674 WP_003440040.1.14686 WP_003440040.1.14698 WP_003440040.1.14848 WP_003440040.1.1494 WP_003440040.1.15083 WP_003440040.1.15205 WP_003440040.1.15310 WP_003440040.1.15435 WP_003440040.1.16135 WP_003440040.1.16185 WP_003440040.1.16520 WP_003440040.1.16728 WP_003440040.1.169 WP_003440040.1.16931 WP_003440040.1.16966 WP_003440040.1.1705 WP_003440040.1.17371 WP_003440040.1.17413 WP_003440040.1.17463 WP_003440040.1.17512 WP_003440040.1.17611 WP_003440040.1.17638 WP_003440040.1.17808 WP_003440040.1.17851 WP_003440040.1.17879 WP_003440040.1.17908 WP_003440040.1.17960 WP_003440040.1.18060 WP_003440040.1.18207 WP_003440040.1.18212 WP_003440040.1.18298 WP_003440040.1.1838 WP_003440040.1.18407 WP_003440040.1.18455 WP_003440040.1.18462 WP_003440040.1.18551 WP_003440040.1.18680 WP_003440040.1.18805 WP_003440040.1.18970 WP_003440040.1.19152 WP_003440040.1.1926 WP_003440040.1.19290 WP_003440040.1.19648 WP_003440040.1.19704 WP_003440040.1.19899 WP_003440040.1.19956 WP_003440040.1.1999 WP_003440040.1.2002 WP_003440040.1.20184 WP_003440040.1.20302 WP_003440040.1.20313 WP_003440040.1.20481 WP_003440040.1.20650 WP_003440040.1.20728 WP_003440040.1.20872 WP_003440040.1.20875 WP_003440040.1.20960 WP_003440040.1.21000 WP_003440040.1.21048 WP_003440040.1.21201 WP_003440040.1.21220 WP_003440040.1.21417 WP_003440040.1.21520 WP_003440040.1.21547 WP_003440040.1.21618 WP_003440040.1.21704 WP_003440040.1.21893 WP_003440040.1.22020 WP_003440040.1.22079 WP_003440040.1.22222 WP_003440040.1.22228 WP_003440040.1.22313 WP_003440040.1.22411 WP_003440040.1.22417 WP_003440040.1.22569 WP_003440040.1.22615 WP_003440040.1.22768 WP_003440040.1.22893 WP_003440040.1.22937 WP_003440040.1.23096 WP_003440040.1.23208 WP_003440040.1.23287 WP_003440040.1.23338 WP_003440040.1.2363 WP_003440040.1.24197 WP_003440040.1.24457 WP_003440040.1.24520 WP_003440040.1.24889 WP_003440040.1.24900 WP_003440040.1.25416 WP_003440040.1.25761 WP_003440040.1.26024 WP_003440040.1.26358 WP_003440040.1.26482 WP_003440040.1.26494 WP_003440040.1.26697 WP_003440040.1.26829 WP_003440040.1.26940 WP_003440040.1.2758 WP_003440040.1.27677 WP_003440040.1.27708 WP_003440040.1.27824 WP_003440040.1.27872 WP_003440040.1.27881 WP_003440040.1.27890 WP_003440040.1.27967 WP_003440040.1.27989 WP_003440040.1.27996 WP_003440040.1.28055 WP_003440040.1.28410 WP_003440040.1.28638 WP_003440040.1.28715 WP_003440040.1.28856 WP_003440040.1.28882 WP_003440040.1.28890 WP_003440040.1.28930 WP_003440040.1.2923 WP_003440040.1.293 WP_003440040.1.29600 WP_003440040.1.29757 WP_003440040.1.2982 WP_003440040.1.29891 WP_003440040.1.3024 WP_003440040.1.303 WP_003440040.1.3031 WP_003440040.1.30420 WP_003440040.1.30431 WP_003440040.1.30463 WP_003440040.1.30519 WP_003440040.1.30521 WP_003440040.1.30743 WP_003440040.1.30841 WP_003440040.1.30953 WP_003440040.1.31160 WP_003440040.1.31183 WP_003440040.1.31203 WP_003440040.1.31292 WP_003440040.1.31351 WP_003440040.1.31385 WP_003440040.1.31453 WP_003440040.1.31475 WP_003440040.1.31477 WP_003440040.1.31637 WP_003440040.1.31742 WP_003440040.1.31960 WP_003440040.1.31969 WP_003440040.1.32008 WP_003440040.1.32066 WP_003440040.1.32119 WP_003440040.1.32166 WP_003440040.1.32197 WP_003440040.1.32218 WP_003440040.1.32230 WP_003440040.1.32294 WP_003440040.1.32699 WP_003440040.1.32769 WP_003440040.1.32776 WP_003440040.1.32842 WP_003440040.1.33056 WP_003440040.1.33098 WP_003440040.1.33298 WP_003440040.1.33332 WP_003440040.1.33349 WP_003440040.1.3340 WP_003440040.1.33514 WP_003440040.1.34388 WP_003440040.1.34489 WP_003440040.1.34545 WP_003440040.1.34641 WP_003440040.1.35 WP_003440040.1.35137 WP_003440040.1.35181 WP_003440040.1.35187 WP_003440040.1.35234 WP_003440040.1.35832 WP_003440040.1.35884 WP_003440040.1.36078 WP_003440040.1.36257 WP_003440040.1.36338 WP_003440040.1.36738 WP_003440040.1.36835 WP_003440040.1.374 WP_003440040.1.37493 WP_003440040.1.37532 WP_003440040.1.37597 WP_003440040.1.37861 WP_003440040.1.37957 WP_003440040.1.38305 WP_003440040.1.38338 WP_003440040.1.38692 WP_003440040.1.38814 WP_003440040.1.38874 WP_003440040.1.38924 WP_003440040.1.38986 WP_003440040.1.39008 WP_003440040.1.3913 WP_003440040.1.39213 WP_003440040.1.39350 WP_003440040.1.39382 WP_003440040.1.39442 WP_003440040.1.39525 WP_003440040.1.39621 WP_003440040.1.39874 WP_003440040.1.39876 WP_003440040.1.39975 WP_003440040.1.39981 WP_003440040.1.40030 WP_003440040.1.40313 WP_003440040.1.40447 WP_003440040.1.40522 WP_003440040.1.40557 WP_003440040.1.407 WP_003440040.1.40891 WP_003440040.1.40959 WP_003440040.1.40966 WP_003440040.1.41131 WP_003440040.1.4121 WP_003440040.1.41334 WP_003440040.1.41342 WP_003440040.1.4137 WP_003440040.1.41506 WP_003440040.1.41534 WP_003440040.1.41641 WP_003440040.1.41687 WP_003440040.1.41818 WP_003440040.1.41995 WP_003440040.1.42035 WP_003440040.1.4204 WP_003440040.1.42532 WP_003440040.1.42610 WP_003440040.1.42664 WP_003440040.1.43112 WP_003440040.1.4315 WP_003440040.1.4321 WP_003440040.1.43490 WP_003440040.1.43519 WP_003440040.1.43579 WP_003440040.1.43663 WP_003440040.1.4383 WP_003440040.1.44030 WP_003440040.1.44149 WP_003440040.1.44198 WP_003440040.1.44470 WP_003440040.1.44471 WP_003440040.1.45017 WP_003440040.1.45059 WP_003440040.1.45142 WP_003440040.1.45165 WP_003440040.1.45209 WP_003440040.1.45257 WP_003440040.1.45352 WP_003440040.1.45554 WP_003440040.1.4573 WP_003440040.1.45938 WP_003440040.1.45986 WP_003440040.1.46066 WP_003440040.1.46274 WP_003440040.1.46280 WP_003440040.1.46305 WP_003440040.1.46522 WP_003440040.1.47016 WP_003440040.1.47121 WP_003440040.1.47227 WP_003440040.1.47479 WP_003440040.1.47615 WP_003440040.1.47708 WP_003440040.1.47729 WP_003440040.1.47940 WP_003440040.1.48246 WP_003440040.1.48279 WP_003440040.1.4835 WP_003440040.1.48746 WP_003440040.1.48772 WP_003440040.1.48935 WP_003440040.1.48983 WP_003440040.1.48991 WP_003440040.1.49020 WP_003440040.1.49054 WP_003440040.1.49065 WP_003440040.1.4908 WP_003440040.1.49230 WP_003440040.1.49310 WP_003440040.1.49339 WP_003440040.1.4948 WP_003440040.1.49633 WP_003440040.1.50159 WP_003440040.1.50341 WP_003440040.1.5073 WP_003440040.1.50865 WP_003440040.1.51007 WP_003440040.1.51675 WP_003440040.1.52073 WP_003440040.1.52278 WP_003440040.1.52311 WP_003440040.1.52330 WP_003440040.1.52383 WP_003440040.1.52466 WP_003440040.1.52525 WP_003440040.1.52789 WP_003440040.1.52958 WP_003440040.1.52997 WP_003440040.1.53008 WP_003440040.1.53044 WP_003440040.1.53055 WP_003440040.1.53704 WP_003440040.1.53710 WP_003440040.1.53729 WP_003440040.1.53987 WP_003440040.1.54058 WP_003440040.1.54153 WP_003440040.1.5423 WP_003440040.1.54262 WP_003440040.1.54350 WP_003440040.1.54586 WP_003440040.1.54692 WP_003440040.1.55055 WP_003440040.1.5521 WP_003440040.1.55391 WP_003440040.1.559 WP_003440040.1.56006 WP_003440040.1.56217 WP_003440040.1.56252 WP_003440040.1.56337 WP_003440040.1.5657 WP_003440040.1.5661 WP_003440040.1.5664 WP_003440040.1.56711 WP_003440040.1.56754 WP_003440040.1.56927 WP_003440040.1.5750 WP_003440040.1.57711 WP_003440040.1.57827 WP_003440040.1.58015 WP_003440040.1.58216 WP_003440040.1.58304 WP_003440040.1.58315 WP_003440040.1.58323 WP_003440040.1.58463 WP_003440040.1.58531 WP_003440040.1.58665 WP_003440040.1.58677 WP_003440040.1.58818 WP_003440040.1.58956 WP_003440040.1.5905 WP_003440040.1.59588 WP_003440040.1.59618 WP_003440040.1.59628 WP_003440040.1.59707 WP_003440040.1.59752 WP_003440040.1.59990 WP_003440040.1.6031 WP_003440040.1.60482 WP_003440040.1.60563 WP_003440040.1.6070 WP_003440040.1.60957 WP_003440040.1.61042 WP_003440040.1.61140 WP_003440040.1.61293 WP_003440040.1.61492 WP_003440040.1.61679 WP_003440040.1.61716 WP_003440040.1.61866 WP_003440040.1.61972 WP_003440040.1.62049 WP_003440040.1.62095 WP_003440040.1.62128 WP_003440040.1.62577 WP_003440040.1.62624 WP_003440040.1.62637 WP_003440040.1.62941 WP_003440040.1.62986 WP_003440040.1.63020 WP_003440040.1.63059 WP_003440040.1.63239 WP_003440040.1.63248 WP_003440040.1.63343 WP_003440040.1.63378 WP_003440040.1.63516 WP_003440040.1.63570 WP_003440040.1.63581 WP_003440040.1.63598 WP_003440040.1.63599 WP_003440040.1.63853 WP_003440040.1.64020 WP_003440040.1.64092 WP_003440040.1.64197 WP_003440040.1.64369 WP_003440040.1.64447 WP_003440040.1.64546 WP_003440040.1.64573 WP_003440040.1.64859 WP_003440040.1.65064 WP_003440040.1.65067 WP_003440040.1.65369 WP_003440040.1.65889 WP_003440040.1.66119 WP_003440040.1.66237 WP_003440040.1.66439 WP_003440040.1.66565 WP_003440040.1.66608 WP_003440040.1.66643 WP_003440040.1.66701 WP_003440040.1.6675 WP_003440040.1.66805 WP_003440040.1.66847 WP_003440040.1.6685 WP_003440040.1.66887 WP_003440040.1.66888 WP_003440040.1.66900 WP_003440040.1.670 WP_003440040.1.67303 WP_003440040.1.6736 WP_003440040.1.67368 WP_003440040.1.67528 WP_003440040.1.67689 WP_003440040.1.67695 WP_003440040.1.67711 WP_003440040.1.6792 WP_003440040.1.67951 WP_003440040.1.68150 WP_003440040.1.68955 WP_003440040.1.6898 WP_003440040.1.69114 WP_003440040.1.692 WP_003440040.1.69220 WP_003440040.1.69333 WP_003440040.1.69495 WP_003440040.1.69708 WP_003440040.1.6994 WP_003440040.1.700 WP_003440040.1.70152 WP_003440040.1.70179 WP_003440040.1.70320 WP_003440040.1.70695 WP_003440040.1.70710 WP_003440040.1.70886 WP_003440040.1.71079 WP_003440040.1.71384 WP_003440040.1.71477 WP_003440040.1.7156 WP_003440040.1.71745 WP_003440040.1.7199 WP_003440040.1.72113 WP_003440040.1.72245 WP_003440040.1.72468 WP_003440040.1.72483 WP_003440040.1.72682 WP_003440040.1.72891 WP_003440040.1.72909 WP_003440040.1.72914 WP_003440040.1.73026 WP_003440040.1.73116 WP_003440040.1.7322 WP_003440040.1.73852 WP_003440040.1.73931 WP_003440040.1.74116 WP_003440040.1.74126 WP_003440040.1.74672 WP_003440040.1.74678 WP_003440040.1.74680 WP_003440040.1.74835 WP_003440040.1.74897 WP_003440040.1.75026 WP_003440040.1.751 WP_003440040.1.75210 WP_003440040.1.75454 WP_003440040.1.75638 WP_003440040.1.75659 WP_003440040.1.76207 WP_003440040.1.7650 WP_003440040.1.76550 WP_003440040.1.76603 WP_003440040.1.76664 WP_003440040.1.76687 WP_003440040.1.76793 WP_003440040.1.76813 WP_003440040.1.76882 WP_003440040.1.7696 WP_003440040.1.77092 WP_003440040.1.77102 WP_003440040.1.77473 WP_003440040.1.77544 WP_003440040.1.7755 WP_003440040.1.77639 WP_003440040.1.77782 WP_003440040.1.77842 WP_003440040.1.77942 WP_003440040.1.78123 WP_003440040.1.78579 WP_003440040.1.78949 WP_003440040.1.7916 WP_003440040.1.79199 WP_003440040.1.79221 WP_003440040.1.79344 WP_003440040.1.79437 WP_003440040.1.79611 WP_003440040.1.79680 WP_003440040.1.79703 WP_003440040.1.79836 WP_003440040.1.80052 WP_003440040.1.80144 WP_003440040.1.80379 WP_003440040.1.80455 WP_003440040.1.80504 WP_003440040.1.81035 WP_003440040.1.81044 WP_003440040.1.81208 WP_003440040.1.81299 WP_003440040.1.81402 WP_003440040.1.81605 WP_003440040.1.81777 WP_003440040.1.82084 WP_003440040.1.82169 WP_003440040.1.82335 WP_003440040.1.82635 WP_003440040.1.82701 WP_003440040.1.82920 WP_003440040.1.8314 WP_003440040.1.83148 WP_003440040.1.83175 WP_003440040.1.83255 WP_003440040.1.83287 WP_003440040.1.83288 WP_003440040.1.83318 WP_003440040.1.83348 WP_003440040.1.834 WP_003440040.1.83477 WP_003440040.1.83515 WP_003440040.1.84253 WP_003440040.1.84528 WP_003440040.1.84843 WP_003440040.1.84880 WP_003440040.1.84923 WP_003440040.1.85020 WP_003440040.1.85127 WP_003440040.1.85214 WP_003440040.1.85219 WP_003440040.1.8527 WP_003440040.1.85420 WP_003440040.1.85442 WP_003440040.1.85454 WP_003440040.1.85776 WP_003440040.1.85863 WP_003440040.1.8587 WP_003440040.1.85874 WP_003440040.1.86008 WP_003440040.1.86011 WP_003440040.1.86049 WP_003440040.1.86088 WP_003440040.1.86094 WP_003440040.1.86116 WP_003440040.1.86117 WP_003440040.1.86328 WP_003440040.1.86395 WP_003440040.1.86534 WP_003440040.1.86743 WP_003440040.1.86767 WP_003440040.1.86837 WP_003440040.1.86914 WP_003440040.1.87058 WP_003440040.1.87326 WP_003440040.1.87454 WP_003440040.1.87714 WP_003440040.1.87723 WP_003440040.1.87730 WP_003440040.1.87918 WP_003440040.1.87932 WP_003440040.1.882 WP_003440040.1.88332 WP_003440040.1.88364 WP_003440040.1.88372 WP_003440040.1.88377 WP_003440040.1.88608 WP_003440040.1.88996 WP_003440040.1.89065 WP_003440040.1.89196 WP_003440040.1.89337 WP_003440040.1.89629 WP_003440040.1.89697 WP_003440040.1.90076 WP_003440040.1.90101 WP_003440040.1.90329 WP_003440040.1.9041 WP_003440040.1.90491 WP_003440040.1.90555 WP_003440040.1.90643 WP_003440040.1.9083 WP_003440040.1.90921 WP_003440040.1.90938 WP_003440040.1.90981 WP_003440040.1.91065 WP_003440040.1.91314 WP_003440040.1.91406 WP_003440040.1.91648 WP_003440040.1.92075 WP_003440040.1.92284 WP_003440040.1.92371 WP_003440040.1.92658 WP_003440040.1.92697 WP_003440040.1.92941 WP_003440040.1.93044 WP_003440040.1.93171 WP_003440040.1.93313 WP_003440040.1.93360 WP_003440040.1.93480 WP_003440040.1.93615 WP_003440040.1.93687 WP_003440040.1.93717 WP_003440040.1.93766 WP_003440040.1.93782 WP_003440040.1.93798 WP_003440040.1.93802 WP_003440040.1.93830 WP_003440040.1.9393 WP_003440040.1.94067 WP_003440040.1.94073 WP_003440040.1.94166 WP_003440040.1.94427 WP_003440040.1.94968 WP_003440040.1.95095 WP_003440040.1.95173 WP_003440040.1.9522 WP_003440040.1.95350 WP_003440040.1.95517 WP_003440040.1.9580 WP_003440040.1.95847 WP_003440040.1.95893 WP_003440040.1.96113 WP_003440040.1.9635 WP_003440040.1.96503 WP_003440040.1.96505 WP_003440040.1.9666 WP_003440040.1.96690 WP_003440040.1.96765 WP_003440040.1.97219 WP_003440040.1.97458 WP_003440040.1.97672 WP_003440040.1.97682 WP_003440040.1.97806 WP_003440040.1.98514 WP_003440040.1.98622 WP_003440040.1.98698 WP_003440040.1.98715 WP_003440040.1.98748 WP_003440040.1.98856 WP_003440040.1.98997 WP_003440040.1.99064 WP_003440040.1.99134 WP_003440040.1.99333 WP_003440040.1.99542 WP_003440040.1.99545 WP_003440040.1.99731 WP_003440040.1.9986 YP_001089637.1.32744 272563.CD3122 645462.CD196_2919 645463.CDR20291_2966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]