SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260684884|ref|YP_003216169.1| from Clostridium difficile CD196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260684884|ref|YP_003216169.1|
Domain Number 1 Region: 6-103
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.77e-33
Family HxlR-like 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|260684884|ref|YP_003216169.1|
Sequence length 107
Comment transcriptional regulator [Clostridium difficile CD196]
Sequence
MKKCLDNYSCPIEATLALIGGKYKTLILWHLKDTILRFNELKKLIPKATPKMLTQQLREL
ESDGLIIRVVYPVVPPKVEYSLSDFGKSIIPILDSMCDWGSDYLESL
Download sequence
Identical sequences A0A0H3N6G2 A0A1F2D5N8 C9YRI3
gi|260684884|ref|YP_003216169.1| 645462.CD196_3154 645463.CDR20291_3200 gi|260688542|ref|YP_003219676.1| gi|384362551|ref|YP_006200403.1| WP_009891827.1.100097 WP_009891827.1.100139 WP_009891827.1.10130 WP_009891827.1.10488 WP_009891827.1.11025 WP_009891827.1.12169 WP_009891827.1.1273 WP_009891827.1.12809 WP_009891827.1.13040 WP_009891827.1.13251 WP_009891827.1.13398 WP_009891827.1.14170 WP_009891827.1.14205 WP_009891827.1.1445 WP_009891827.1.14483 WP_009891827.1.14674 WP_009891827.1.15310 WP_009891827.1.16520 WP_009891827.1.16728 WP_009891827.1.16931 WP_009891827.1.17638 WP_009891827.1.17851 WP_009891827.1.17879 WP_009891827.1.17908 WP_009891827.1.18212 WP_009891827.1.18298 WP_009891827.1.18455 WP_009891827.1.18680 WP_009891827.1.19152 WP_009891827.1.19899 WP_009891827.1.20650 WP_009891827.1.20875 WP_009891827.1.21220 WP_009891827.1.21618 WP_009891827.1.22020 WP_009891827.1.22222 WP_009891827.1.22937 WP_009891827.1.2363 WP_009891827.1.26829 WP_009891827.1.2758 WP_009891827.1.27677 WP_009891827.1.27989 WP_009891827.1.2923 WP_009891827.1.2982 WP_009891827.1.303 WP_009891827.1.30519 WP_009891827.1.31160 WP_009891827.1.31183 WP_009891827.1.31351 WP_009891827.1.31385 WP_009891827.1.31475 WP_009891827.1.31742 WP_009891827.1.31960 WP_009891827.1.32119 WP_009891827.1.32230 WP_009891827.1.35181 WP_009891827.1.36338 WP_009891827.1.39525 WP_009891827.1.39876 WP_009891827.1.39975 WP_009891827.1.39981 WP_009891827.1.40522 WP_009891827.1.41342 WP_009891827.1.41534 WP_009891827.1.42664 WP_009891827.1.44471 WP_009891827.1.45165 WP_009891827.1.45257 WP_009891827.1.46066 WP_009891827.1.46522 WP_009891827.1.48279 WP_009891827.1.48935 WP_009891827.1.49339 WP_009891827.1.53044 WP_009891827.1.53704 WP_009891827.1.53710 WP_009891827.1.53729 WP_009891827.1.5423 WP_009891827.1.54262 WP_009891827.1.54692 WP_009891827.1.56217 WP_009891827.1.57711 WP_009891827.1.57827 WP_009891827.1.58323 WP_009891827.1.59588 WP_009891827.1.59707 WP_009891827.1.61492 WP_009891827.1.61679 WP_009891827.1.61972 WP_009891827.1.62637 WP_009891827.1.63248 WP_009891827.1.63581 WP_009891827.1.63853 WP_009891827.1.64197 WP_009891827.1.64447 WP_009891827.1.66119 WP_009891827.1.6675 WP_009891827.1.66888 WP_009891827.1.66900 WP_009891827.1.670 WP_009891827.1.6736 WP_009891827.1.67528 WP_009891827.1.67695 WP_009891827.1.68955 WP_009891827.1.69495 WP_009891827.1.700 WP_009891827.1.70152 WP_009891827.1.71745 WP_009891827.1.72682 WP_009891827.1.72909 WP_009891827.1.7322 WP_009891827.1.73931 WP_009891827.1.74116 WP_009891827.1.74680 WP_009891827.1.751 WP_009891827.1.7650 WP_009891827.1.76687 WP_009891827.1.76813 WP_009891827.1.7755 WP_009891827.1.77782 WP_009891827.1.79199 WP_009891827.1.79611 WP_009891827.1.81208 WP_009891827.1.82335 WP_009891827.1.83515 WP_009891827.1.84843 WP_009891827.1.84880 WP_009891827.1.8527 WP_009891827.1.85442 WP_009891827.1.86328 WP_009891827.1.86395 WP_009891827.1.86534 WP_009891827.1.87058 WP_009891827.1.87454 WP_009891827.1.87730 WP_009891827.1.87932 WP_009891827.1.88372 WP_009891827.1.88377 WP_009891827.1.89337 WP_009891827.1.90076 WP_009891827.1.9041 WP_009891827.1.91065 WP_009891827.1.91406 WP_009891827.1.92658 WP_009891827.1.92941 WP_009891827.1.93360 WP_009891827.1.9522 WP_009891827.1.9580 WP_009891827.1.96765 WP_009891827.1.98622 WP_009891827.1.98748 WP_009891827.1.99731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]