SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284161812|ref|YP_003400435.1| from Archaeoglobus profundus DSM 5631

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284161812|ref|YP_003400435.1|
Domain Number 1 Region: 18-146
Classification Level Classification E-value
Superfamily SIS domain 5.76e-31
Family mono-SIS domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284161812|ref|YP_003400435.1|
Sequence length 206
Comment sugar isomerase (SIS) [Archaeoglobus profundus DSM 5631]
Sequence
MDFGDIVVKNAIKIVDFLKVLPKVLEDQKERLNEFVKILKDSKAIHVYGVGRSGAVALCF
AIRLKHFEKVLGCKVWWVGDEVREKIEEGDTLIAFSGSGETAEVLIVAERAKNANAKVVA
VTSFEDSSLARMADLVIIIPGGLEKRKGWKYLEAQFVGEFYGGGEFELLAYAFQEVLINA
IGEYFGIPKDVVIKEHERNSIHRKSS
Download sequence
Identical sequences D2RHI7
WP_012940098.1.89191 gi|284161812|ref|YP_003400435.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]