SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284162500|ref|YP_003401123.1| from Archaeoglobus profundus DSM 5631

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284162500|ref|YP_003401123.1|
Domain Number 1 Region: 169-268
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000000000327
Family Multidrug resistance efflux transporter EmrE 0.0096
Further Details:      
 
Weak hits

Sequence:  gi|284162500|ref|YP_003401123.1|
Domain Number - Region: 34-127
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00034
Family Multidrug resistance efflux transporter EmrE 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284162500|ref|YP_003401123.1|
Sequence length 272
Comment hypothetical protein Arcpr_1401 [Archaeoglobus profundus DSM 5631]
Sequence
MRCLTVTVSAVLMGSLAIFVRNIDVNPLIVTFLRMAFGLIYLLPAIKLVRFSLFKNLKVL
SLSFVSLLTITFYISSIQLVEMAISALLLYMAPVYVIIFMILRGEDIGRVSIFSLITALF
GLYLLLSPYYSLNFGIIFGIFAGLCYAGYFLLAKEVREFASSIEITFITLLISSLALAPI
ALSFDILSVLEAKLLWLLGLGLIPTAIPFVLLNYGIKFCKKENAPIIALIEPVSAGIFGF
LFFNEVLTLKQLIGAVLILSSVLVALKSGVEG
Download sequence
Identical sequences D2REA6
WP_012940786.1.89191 gi|284162500|ref|YP_003401123.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]