SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284162853|ref|YP_003401476.1| from Archaeoglobus profundus DSM 5631

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|284162853|ref|YP_003401476.1|
Domain Number - Region: 87-216
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 0.0497
Family Type II DNA topoisomerase 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284162853|ref|YP_003401476.1|
Sequence length 241
Comment hypothetical protein Arcpr_1759 [Archaeoglobus profundus DSM 5631]
Sequence
MPQRELYITTDPYTFTSAEGLESLKRALRAISEICNCKVRVVIPTLLYRELEVLKEGEIE
KSILLRPFLIPRRIGIVRMIQLIPVLRQFFYEFKPESAHKYIEEVKEVGPVTRRYIEVEL
LRVRRELLGYPEMRLPIGWLSSLIFDYLALTHRLGALIVSFRRRFVDILQKLKIAVLVAH
SRFKTAVKERARIVRRDLIIIGTALTRDALERLINQFNFDNLPITIAEYLAGKVLIIVAD
G
Download sequence
Identical sequences D2RFA9
WP_012941138.1.89191 gi|284162853|ref|YP_003401476.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]