SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294673065|ref|YP_003573681.1| from Prevotella ruminicola 23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294673065|ref|YP_003573681.1|
Domain Number 1 Region: 303-529
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.35e-40
Family ABC transporter ATPase domain-like 0.0004
Further Details:      
 
Domain Number 2 Region: 24-297
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.00000000000000183
Family DNA repair protein MutS, domain III 0.012
Further Details:      
 
Domain Number 3 Region: 782-855
Classification Level Classification E-value
Superfamily SMR domain-like 0.000000405
Family Smr domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294673065|ref|YP_003573681.1|
Sequence length 857
Comment MutS2 family protein [Prevotella ruminicola 23]
Sequence
MIYPNNFERKLGFDEIRRLLKARCQSTLGQEKVDEMAFSVDADVVNEWLTQVREFRRLTA
EHDDFPMQYFFDVRESIARIRLENTHLEEDEVWDLRRSLETIANIVRFLQRDGDEKPNGE
VVYPYPALYRLTDGVATFPAMIRRIDSILDKFGKVKDSASMTLAGIRHDLEKTQGSISRT
LYTILHAAQRDGLVDKDAAPAMRDGRLVIPVAPQVKRRINGIVHDESATGKTVFIEPTEV
VEANNKVRQLEAEERREVIRILTVFTDEVRPHVREIIDSYQLLAMIDLIQAKAKWAELTL
AFEPTVKAEPVIDWIRAIHPLLQLSLEKKGGHVVPLDIMLNRAKRLLLISGPNAGGKSVC
LKTVGLLQYMLQCGLPVPIGDRSTAGIFESIMIDIGDEQSIENDLSTYSSHLMNMKQMMK
QAGERSLLLIDEFGSGTEPAIGGAIAEAMLKQFWKKRTFGVITTHYQNLKHFADDHEGVV
NGAMLYDRHEMQALFQLSIGQPGSSFAIEIARKTGIPEEVIKDASDIVGQDYIQSDKYLQ
DIVRDKRYWEGKRQTIHQHEKKLQASGERLEAAVEEIEAERKAILRKAREQAEELLRESN
KKIENAIREIREAQAEKERTRKIREELDTFKEELAQVDTRATDEAIAKKMRQIQERKERR
EKRKAEKLSKKEEGGKREDAAAVASAQSSKANIPLQKGDTVRIKGLTSVGVIDSIDGGKA
VVVFGGMKTKMRLERLEHAEKPKEQQTKAEERNSNIAGSYGVVSKDTRNVIDNRKLNFKQ
DIDVRGMRGDEAINAITYFIDDAILVGVSRVRILHGTGTGILRQLIRQYLGTIPNVSHYR
DEHVQFGGAGITVVDLE
Download sequence
Identical sequences A0A1H6MD14 D5EWC6
gi|294673065|ref|YP_003573681.1| WP_013063296.1.33358 WP_013063296.1.49956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]