SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294673371|ref|YP_003573987.1| from Prevotella ruminicola 23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294673371|ref|YP_003573987.1|
Domain Number 1 Region: 61-146
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 4.45e-19
Family Ribosomal protein L9 C-domain 0.001
Further Details:      
 
Domain Number 2 Region: 1-56
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.00000000000000366
Family Ribosomal protein L9 N-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294673371|ref|YP_003573987.1|
Sequence length 196
Comment 50S ribosomal protein L9 [Prevotella ruminicola 23]
Sequence
MEIILKEDIIGLGFKNDIVNVKSGYGRNYLIPQGKGVIASPSAKKILAENLKQQAHKLAA
LKAAAEEKAAQLNGVVVEVAAKVSVTGQLYGSVGAAQVADELAKLGKEVDRKIITMKDAK
KVGDYVALVHFHKEVIVELPVKVVAENAAELQAAADAEAAIKAAADAKKAAANEAEAAEA
ADEAEALEAIDAPAEA
Download sequence
Identical sequences A0A1H1CB04 A0A1M7NTM6 D5EYD8
gi|294673371|ref|YP_003573987.1| WP_013064329.1.33358 WP_013064329.1.42703 WP_013064329.1.44726 WP_013064329.1.47345 WP_013064329.1.49956 WP_013064329.1.69841 WP_013064329.1.78806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]