SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294674460|ref|YP_003575076.1| from Prevotella ruminicola 23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294674460|ref|YP_003575076.1|
Domain Number 1 Region: 3-445
Classification Level Classification E-value
Superfamily SIS domain 4.58e-128
Family Phosphoglucose isomerase, PGI 0.000000000934
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294674460|ref|YP_003575076.1|
Sequence length 449
Comment glucose-6-phosphate isomerase [Prevotella ruminicola 23]
Sequence
MEMIKLDITKAACFLKEGAVESFEPKVAEAQKALEAGTCPGNDFLGWLHLPSSITPAFLD
ELQACADTLRANCDAIVVAGIGGSYLGARAVIEALSNAFSWLVNDPKNPTILFAGNNIGE
DYLFELTEYLKGKKFGVINISKSGTTTETALTFRLLKKQCEAQRGKEEAKKVIVAVTDAK
KGAARTCADKEGYKSFIIPDNVGGRFSVLTPVGLLPIACAGFSIKDLVAGAQEMEKACAP
TVPFAENPAAQYAAVRNGLYQSGKKIEIMVNFQPKLHFFSEWWKQLYGESEGKDGKGIFP
ASVDFTTDLHSMGQWIQEGERTIFETVISVEEPEKKLLFPNDEENLDGLNFLAGKRVDEV
NKMAELGTQLAHVDGGVPNMRISVPKLNEYYIGQLIYFFEIACGISGNVLGVNPFNQPGV
EAYKKNMFALLDKPGYEAESAAIKARLAK
Download sequence
Identical sequences A0A1H6JT07 D5ETX2
gi|294674460|ref|YP_003575076.1| WP_013064534.1.33358 WP_013064534.1.49956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]