SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294675021|ref|YP_003575637.1| from Prevotella ruminicola 23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294675021|ref|YP_003575637.1|
Domain Number 1 Region: 12-247
Classification Level Classification E-value
Superfamily SIS domain 6.9e-64
Family mono-SIS domain 0.00000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294675021|ref|YP_003575637.1|
Sequence length 270
Comment N-acetylmuramic acid 6-phosphate etherase [Prevotella ruminicola 23]
Sequence
MRIEDKITEQASHYDHLEQMEVGEVLRSINQEDRLVAEAVGRVLPQIETLVLAIEPRMKR
GGRLFYVGAGTSGRLGVLDASELPPTFGVQPDWVIGLIAGGDEALRRAVERAEDDKEQGW
NDLMRYQPTADDTVIGIAASGTTPYVIGAIKGARKQGLLTGCITSNPHTPLAAAAEYAIE
TIVGPEFVTGSSRMKSGTAQKMVLNMISTALMIRMGRVEGNRMVKMQLTNEKLIDRGTRM
IADELGISYDEARQRLLAAGSVDVVLKQKL
Download sequence
Identical sequences A0A1H6LHR7 D5EVY2
WP_013064770.1.33358 WP_013064770.1.49956 gi|294675021|ref|YP_003575637.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]